KEGG   Shewanella sp. MR-7: Shewmr7_3099Help
Entry
Shewmr7_3099      CDS       T00389                                 

Definition
(GenBank) hypothetical protein
Organism
shm  Shewanella sp. MR-7
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABI44083
UniProt: Q0HS22
Position
complement(3675977..3676477)
Genome map
AA seq 166 aa AA seqDB search
MISREEMSFEQEFTEKVGGYLDNLTDELQPILKQLIEHDYPQEVVTLAFEVFGDSFSSQF
PVRVFFMDKDNTEYFIDLDGKAAYPSPVSPNLLDIDHVYPDEFEEEYIEKDEDLDPWHIA
TNALIEWFSPCWIAAGGQNFKLKANIAPHDSHYEFNLVECQWQERC
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgataagcagggaagagatgagtttcgagcaagagtttacagaaaaagtcggtggttac
ttagacaatctcaccgatgagttacagcccattcttaagcaactgattgagcatgattat
ccccaagaggtggtcacgctggcgtttgaagtctttggcgatagtttttcatcccaattc
ccggtgcgggtattttttatggataaagataacaccgagtattttatcgatctcgatggc
aaggccgcatatccgtctccagtcagtccaaatttgctcgacatagaccatgtctatccc
gatgagtttgaagaggaatatatcgaaaaggatgaggaccttgacccttggcatatcgcg
acaaacgcgcttatcgaatggttctctccgtgctggattgccgcaggcggccaaaacttt
aagttaaaggccaatatcgccccccacgacagccactatgagttcaatttggtagagtgt
cagtggcaagaacgatgctaa

DBGET integrated database retrieval system