KEGG   Shewanella sp. MR-7: Shewmr7_3101Help
Entry
Shewmr7_3101      CDS       T00389                                 

Definition
(GenBank) phosphoribosylglycinamide formyltransferase 2
  KO
K08289  phosphoribosylglycinamide formyltransferase 2 [EC:2.1.2.2]
Organism
shm  Shewanella sp. MR-7
Pathway
shm00230  Purine metabolism
shm00670  One carbon pool by folate
shm01100  Metabolic pathways
shm01110  Biosynthesis of secondary metabolites
shm01130  Biosynthesis of antibiotics
Module
shm_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:shm00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Shewmr7_3101
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Shewmr7_3101
Enzymes [BR:shm01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.2  phosphoribosylglycinamide formyltransferase
     Shewmr7_3101
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp ATP-grasp_3 Dala_Dala_lig_C CPSase_L_D2 ATPgrasp_Ter 2-Hacid_dh_C GARS_A Epimerase TrkA_N
Motif
Other DBs
NCBI-ProteinID: ABI44085
UniProt: Q0HS20
Position
3678399..3679574
Genome map
AA seq 391 aa AA seqDB search
MIGTPYTEGARRAMLLGCGELGKEVAIELQRLGVEVIGVDRYPNAPAMQIAHRSHVINML
DAKALRAIIELEKPHLVIPEIEAIATQTLVEMEAEGLNVVPTARATQLTMDREGIRRLAA
ETLGLPTSPYFFCDTETEFNQAIGKIGVPCVVKPVMSSSGKGQSVIRDVSQSAKAWQYAQ
EGGRAGGGRVIVEGFIPFDYEITLLTISAVNGIHFCAPIGHRQEDGDYRESWQPQAMSAD
VLAKSQAIASKVVEALGGYGLFGVELFVKGNDVYFSEVSPRPHDTGLVTLISQDLSEFAL
HVRAILGLPIPNIHQHGPSASAVVLVEGKSKNIRYQGLADALAAENTQLRLFAKPEIDGR
RRLGVALARDKDIESAVNKALDSASKVKVIF
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgataggaactccctacacagagggcgctcgacgcgccatgttgcttggctgcggtgag
ctaggtaaagaagtcgccatcgagctccaacgcttaggtgttgaagtgattggcgtcgat
cgttaccccaatgcccctgccatgcaaattgcccatcgctcccatgtgatcaatatgctc
gacgctaaagcgcttcgcgccattatcgagctagaaaagccccacttagtgatcccagaa
attgaagctatcgccactcaaaccttagttgagatggaagccgaaggtctcaatgtcgtg
ccgacagcgcgcgcgactcagctaaccatggacagagaaggcattcgtcgcctcgccgcc
gaaaccttaggtctaccgacctcgccctatttcttctgcgacactgaaaccgagtttaat
caagccattggcaagattggcgtgccctgcgtagtcaaacccgtgatgagttcatcgggc
aagggccaaagtgttatccgtgatgtatcccaaagcgccaaagcctggcaatacgcccaa
gaaggtggccgcgcgggcggtggtcgtgtgattgtcgaaggctttatccccttcgattac
gaaattaccctgctgaccatcagcgcagtcaatggcatccacttctgcgcgccaattggc
cacagacaagaagacggcgactaccgcgagtcatggcaacctcaagccatgtcggccgac
gtgctagcaaaatcccaagcaatcgccagcaaagtggtggaagccctcggcggttacggc
ttatttggggtcgagctgtttgtgaaggggaacgatgtgtacttctctgaagtctcgcct
cgtccgcacgataccggtttagtcaccttaattagccaagatttgtccgagtttgcactg
catgtcagggcgattcttggtctacctattccgaatatccaccaacatggccccagcgcc
tcggcggtagtattggtggaaggcaaatcgaaaaacattcgctatcaaggtcttgccgat
gccttggcggcggaaaatactcagctcagattattcgctaagcctgaaatcgatggtcgc
cgccgtttaggggttgccctcgcccgcgataaagatatcgaaagcgcagtcaataaagcg
ctggatagtgcatctaaggtaaaagtgattttctag

DBGET integrated database retrieval system