KEGG   Shewanella sp. MR-7: Shewmr7_3102Help
Entry
Shewmr7_3102      CDS       T00389                                 

Definition
(GenBank) conserved hypothetical protein
Organism
shm  Shewanella sp. MR-7
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3142 EAL BatA
Motif
Other DBs
NCBI-ProteinID: ABI44086
UniProt: Q0HS19
Position
3679800..3681308
Genome map
AA seq 502 aa AA seqDB search
MDLRSRYSTLFHSKRFQSRRFHSSRFQSKHFEPKRSKSLQAINRTLALLLRLSQLLALAF
GLVFLSACQPANHDTSSIKTATTAPRELTQEVYVWQRQWRNANQSALVESQNAFNGVRIL
ALQAHPKANGADIWFEVQVNHAWLQADPRPKVAVIRLDGQLTRLNNREVIQKILALVQDW
QAKGTKLAGIEIDHDSASSKLAAYNAFLRELKSQLPHTLKLSITSLPAWLSSPEFPPLFD
NIDELVLQIHSVSDPRLGLFDTTQGWQWVEQLSRLAKVPYLIALPSYGSAVYSTASGYRV
ESEVPMRMPLADTASSQHVARQELMADPQVLQSFVKKLHTFADPRLKGMIWFRLPLEGDK
RVWPLSTLIAVAQQQPLAPHIELEILNQANTESPQHEAPGSRLFQLVLVNKGNLAGKLPS
QLSLAAQACSGYDAQNGYQAKLTQGTLVWQLPQATSTERAAAPASSQFAPNLISAVELSP
NGRRVIGWARCESLYLQGIYAP
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atggatttacgcagtcgttattccactctctttcactctaagcgctttcagtctagacgc
tttcactctagtcgctttcagtccaagcactttgagcccaaacgctcaaaatccttgcaa
gcgataaatcgcacccttgcacttttgctcaggttatcccagctactggcgttagccttt
ggcttagttttccttagtgcctgtcagcctgcgaatcatgatacatcgagcataaaaaca
gccaccaccgccccgcgtgaattaacccaagaggtatatgtgtggcagcggcaatggcgc
aatgccaatcaaagcgccttggtcgaaagccaaaacgcgtttaatggcgtgcgcatctta
gcattgcaagcccatcctaaagccaatggcgcggatatctggtttgaagtgcaggtcaat
catgcctggttacaggccgatcctcgccctaaagtggcggtgataagattagatggccaa
cttacgcgcctaaataatcgcgaagtcatccaaaaaatcctcgcactagttcaagactgg
caggcaaagggcactaaacttgcgggaattgaaatcgatcacgatagcgccagcagtaaa
ctcgcggcctataacgcttttttacgcgagttaaaaagccaattaccccacacgctaaaa
ctcagcattacctcattgcccgcttggctcagcagcccagagtttccgccgttgtttgac
aatatcgatgagctggtactgcaaattcacagtgtcagcgacccgcgtttagggctgttc
gacaccacccaaggttggcaatgggtcgagcagttatcacgcttagctaaggtaccctat
ttgattgccctgccatcctacggctcggcggtgtatagcacggcatcgggttatcgagtg
gagagtgaagtgccgatgcgaatgcctttggcagacacggcatcttcgcagcatgttgcg
cgccaagagctgatggccgatccacaggtattgcagtccttcgttaaaaaactgcacacc
tttgctgacccaaggcttaagggaatgatttggtttcgattacccctcgaaggcgataaa
cgggtttggccactctcgaccctgattgcggtcgcccagcagcaaccactcgccccgcac
attgagctagaaatcttaaaccaagccaataccgagtcgccccaacatgaggcgccggga
agccgcttatttcaactggtgctagtcaataagggcaatcttgcaggcaagttaccgagc
cagttgtccctagcggcgcaggcgtgcagcgggtatgatgcgcaaaacggttatcaagcc
aaattaacccaaggaacattagtgtggcagttaccgcaagccacctcaacggagcgcgca
gccgcaccagcctcctcgcagtttgcgccgaatttaatctcagcggtcgagctaagccca
aacggacgcagagtcataggctgggcacgttgtgagtcattatatttacagggaatttat
gcgccataa

DBGET integrated database retrieval system