KEGG   Shewanella sp. MR-7: Shewmr7_3104Help
Entry
Shewmr7_3104      CDS       T00389                                 

Definition
(GenBank) hypothetical protein
Organism
shm  Shewanella sp. MR-7
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABI44088
UniProt: Q0HS17
Position
3684623..3685294
Genome map
AA seq 223 aa AA seqDB search
MNYQKFVALLASEDPMKELTNILIDANTDALKRGASMGWVMALSLDFGSYKETFLDESKS
QNDVDEYFISYYSSDFEETIKYFLLEDSDILPAALKSLLSESVWAFENQKYQICIPALFS
IIEGALVDLSNNGERKNIKYKQGLDDAVVTDRSLNFAVLPLISLSWFLDYAFKKSDFDQS
NFVELNRHWALHGRYLDILGIKPALQLFSVVALILFCYKLQKV
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
ttgaattatcagaaatttgttgcactcttagcttcagaagatccgatgaaagagttaacc
aatatactaattgatgcgaacacagatgctttaaaaagaggcgctagtatggggtgggtt
atggcgctttctttagatttcggctcatacaaagagacttttttggacgagagtaaatca
caaaatgatgtagatgagtattttattagttactactcgagcgattttgaagaaacaatt
aaatacttccttctcgaggatagtgatattcttcctgctgcacttaaatcgctacttagc
gagtccgtttgggcatttgaaaatcagaaatatcaaatatgtattcctgcattattctca
attattgagggagcgttagttgatctctctaataatggtgaacgaaagaatataaaatac
aaacaaggtttagacgatgctgttgtaactgaccgttcactaaattttgctgttttacca
ctaatttcattgtcttggtttttagactatgcatttaagaaaagtgacttcgatcaaagc
aactttgttgaattaaatcgccactgggcactacatggcagatatttagatatacttggc
attaaacctgcgttgcagcttttttctgttgtagctctgattttgttttgctataagttg
caaaaggtatag

DBGET integrated database retrieval system