KEGG   Shewanella sp. MR-7: Shewmr7_3110Help
Entry
Shewmr7_3110      CDS       T00389                                 

Definition
(GenBank) Nucleotidyl transferase
  KO
K00992  N-acetyl-alpha-D-muramate 1-phosphate uridylyltransferase [EC:2.7.7.99]
Organism
shm  Shewanella sp. MR-7
Pathway
shm00520  Amino sugar and nucleotide sugar metabolism
shm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:shm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Shewmr7_3110
Enzymes [BR:shm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.99  N-acetyl-alpha-D-muramate 1-phosphate uridylyltransferase
     Shewmr7_3110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD
Motif
Other DBs
NCBI-ProteinID: ABI44094
UniProt: Q0HS11
Position
complement(3689377..3690045)
Genome map
AA seq 222 aa AA seqDB search
MKAMILAAGRGERLRPLTDTLPKPLVPVLGKPLIVYHIEKLAAAGIVDIVINHAWLGHKL
VETLGDGQAFGVKIQYSAEASALETGGGIKQALPLLTDGDSDAPFLVLNGDVFIDALPTI
APLADTAQAHLWLVPNPEQHPNGDFALEQGLVREQGEQKYTFSGMGLYRPSLFDGTPDGA
FALGPLLRAKMADGLITGAHFNGLWCDVGTIPRLQALESALA
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgaaggccatgatcctcgcggcaggcaggggagagcgtttacgccccttgaccgacacc
ctgcccaaacctttagtgcccgtcttaggtaaaccgctgattgtgtaccatattgagaag
ttggccgcggcgggtatcgtcgatatcgtgataaatcacgcttggcttgggcacaagctg
gtcgaaaccctaggcgatggtcaggcctttggggtcaagatccaatatagcgccgaagca
tcggccctcgagaccggtggcggaattaagcaggcattgcccctgctgactgacggcgac
tcggatgcaccgtttttagtgctcaatggcgatgtgtttatcgatgccttgccgacgatt
gctcccttagcggatactgctcaagcgcatttatggttggtgccaaatccagagcaacat
cctaacggcgactttgccttggaacagggccttgtacgtgaacagggtgagcaaaaatat
actttctctggcatgggcttatatcgcccatcattatttgacggcacgccggatggtgcc
tttgcccttgggcctttgctgcgggctaaaatggccgatggcctgatcactggagcacac
tttaatggactctggtgcgatgttgggacgattccacgtctgcaagcattagagtcagcg
ctggcgtaa

DBGET integrated database retrieval system