KEGG   Shewanella sp. MR-7: Shewmr7_3598Help
Entry
Shewmr7_3598      CDS       T00389                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
shm  Shewanella sp. MR-7
Pathway
shm00010  Glycolysis / Gluconeogenesis
shm00020  Citrate cycle (TCA cycle)
shm00620  Pyruvate metabolism
shm01100  Metabolic pathways
shm01110  Biosynthesis of secondary metabolites
shm01120  Microbial metabolism in diverse environments
shm01130  Biosynthesis of antibiotics
shm01200  Carbon metabolism
Module
shm_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:shm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Shewmr7_3598
   00020 Citrate cycle (TCA cycle)
    Shewmr7_3598
   00620 Pyruvate metabolism
    Shewmr7_3598
Enzymes [BR:shm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Shewmr7_3598
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H HlyD_D23 RnfC_N Peptidase_M23 PYNP_C HlyD_3
Motif
Other DBs
NCBI-ProteinID: ABI44578
UniProt: Q0HQM7
Position
complement(4276126..4278141)
Genome map
AA seq 671 aa AA seqDB search
MAELKEVFVPDIGGDEVQIIEICASVGDTLAAEESILTVESDKATMDIPAPFAGVLAELK
VAVGDKVSEGTLIAMMQAAGTANVQAAPVAQAAAPAPAPAAPAPVQAAPAPVAAAPATGA
TQVVEVTVPDIGGDTDVSVIEVLVAAGDKIEVDAGLITLETDKATMDVPSPFAGVVKEVK
VAVGDKVSQGSLVIMLEVGGAAPAAAPQASAPAASAPVAQAAPAAPVAPVAAASPVVAVK
EIQVPDIGDASNVDVIEVLVSVGDDITVDQGLITLETDKATMEVPAPFAGKLLSLTVKVG
DKVSQGSVIATIETVTAGAAPAPQAAAPAPVAQEAAPAPVAAAPSRPPVPHHPSAGAPVA
TGVVHASPAVRRLAREFGVDLTQVTGSGRKGRIMKEDVQAYVKYELSRPKATAATSVAAG
NGGGLQVIAAPKVDFSKFGEVEEIPLSRIQKISGPNLHRNWVTIPHVTQFDEADITEMEE
FRKQQNDAAAKKKADYKITPLVFMMKAVAKTLQQFPVFNSSLSSDGESLIQKKYYHIGVA
VDTPNGLVVPVVRDVDKKGIIELSRELADISVRARDGKLKSADMQGSCFTISSLGGIGGT
AFTPIVNYPDVAILGVSKSEIKPKWNGKEFEPKLMLPLSLSYDHRVIDGAMAARFSVTLS
GILSDIRTLIL
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atggctgaattaaaagaagtttttgttcctgatatcggcggcgatgaagtacagattatc
gaaatctgtgcttctgtgggcgataccttagcagcggaagagtcgattctgaccgttgaa
agcgacaaggcgaccatggacattcctgcgcctttcgcgggtgtgttagccgaattgaaa
gtggccgtcggtgacaaagtcagcgaaggtaccttaattgcgatgatgcaagcagcgggc
acggctaatgttcaagctgcgcctgttgctcaagctgccgctcctgcgccagcccctgca
gcacctgcaccagtacaagcggctccagcccctgtggctgccgcgccagcgacgggcgca
acccaagtggttgaagtcactgtgccggatatcggtggtgacaccgacgtgtcagttatc
gaagtcttagttgccgctggcgataagattgaggttgacgctggccttatcacgcttgaa
accgacaaagcgaccatggacgtaccatcgccattcgcgggtgtggtaaaagaagtgaaa
gtggcagtgggtgacaaggtttctcaaggctcattagtgatcatgctcgaagtgggcggc
gcggcacctgctgcagcgccacaagcgagcgcgccagcagcctctgcacctgtcgctcaa
gcggctcctgctgcgccagttgctccagtagccgctgcatcaccagtggttgcggttaaa
gaaatccaagtgcctgatattggcgatgcgagcaatgtcgatgtgatcgaagtgctcgtg
tctgtgggtgatgacatcacagttgatcaaggtttaattacccttgaaaccgataaagcg
accatggaagtacctgcgccattcgccggtaaactgttgtcgttaaccgttaaagtgggt
gacaaggtttctcaaggcagcgtgattgcgacgattgaaactgtgactgctggtgcagct
cctgcacctcaagcagcagcgccagcaccagttgcccaagaagcggcaccagcgcctgtt
gcagccgctcctagccgtccacctgttccacatcacccaagtgcgggtgcgccagtggca
accggtgtggtgcatgcgtctccagcggttcgtcgtttggcccgtgaatttggtgtggac
ctcactcaagtgacgggttctggccgtaaaggtcgcatcatgaaggaagacgtacaggcg
tatgtgaagtacgaactgtctcgtcctaaggcgacagcagcaacttcagttgcagcgggt
aacggtggtggtctgcaagtgattgctgcaccgaaagtggatttcagcaagtttggtgaa
gtggaagagattccattaagccgtatccagaagatctctggtccaaacctgcaccgtaac
tgggtaaccattcctcacgtgactcagttcgatgaagctgatatcaccgaaatggaagag
ttccgtaagcagcagaacgacgcggcggcgaagaaaaaagccgattataagatcactccg
ctggtctttatgatgaaagccgtggcgaaaacgctgcaacagttcccagtgttcaactca
agcttaagcagcgacggtgaatcactgatccagaagaagtactaccacatcggtgtggcg
gttgatacgccaaacggtctagtggtacctgtggtacgtgacgtggataagaaagggatc
atcgagttatctcgtgagctggccgatatttctgtccgtgcccgcgatggtaagctcaaa
tctgccgatatgcagggcagctgcttcactatttcaagcctaggtggcattggtggtact
gcgtttaccccaatcgttaactacccagacgtggcgattttaggtgtgtctaaatctgaa
attaagcctaaatggaatggtaaagagttcgagcctaaattgatgttgccactgtcgcta
tcatacgatcaccgcgtgatcgatggtgctatggctgcacgctttagcgtgaccctgtca
ggaattctgtccgatattcgtactttgattctgtaa

DBGET integrated database retrieval system