KEGG   Shewanella sp. ANA-3: Shewana3_0213
Entry
Shewana3_0213     CDS       T00428                                 

Definition
(GenBank) SSU ribosomal protein S8P
  KO
K02994  small subunit ribosomal protein S8
Organism
shn  Shewanella sp. ANA-3
Pathway
shn03010  Ribosome
Brite
KEGG Orthology (KO) [BR:shn00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Shewana3_0213
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:shn03011]
    Shewana3_0213
Ribosome [BR:shn03011]
 Ribosomal proteins
  Bacteria
   Small subunit
    Shewana3_0213
  Archaea
    Shewana3_0213
SSDB
Motif
Pfam: Ribosomal_S8
Other DBs
NCBI-ProteinID: ABK46457
UniProt: A0KRN8
Position
250012..250404
AA seq 130 aa
MSMQDPIADMLTRIRNGQAANKVSVKMPSAKLKVAIAKLLKEEGYIADYAVADEAKPELE
ITLKYFQGQPVVETIQRVSRPGLRIYKGKNELPKVMGGLGVAIVSTSKGLMTDRAARLAG
MGGEVICYVA
NT seq 393 nt   +upstreamnt  +downstreamnt
atgagcatgcaagatcctattgcggatatgttaacccgtattcgtaacggccaagctgct
aacaaagtatctgtgaagatgccttctgctaagctgaaagtcgctatcgcgaaactgctt
aaagaagaaggttacatcgctgattacgccgtagcagatgaagccaagcctgaactggaa
atcactttaaagtatttccaaggccaaccagtcgttgagactatccagcgcgtaagccgt
cctggtcttcgtatttacaaaggtaaaaacgaattaccaaaagtgatgggcggactgggt
gtcgcaattgtgtccacttctaaaggcctgatgactgatcgtgccgcccgccttgcaggc
atgggtggcgaggttatctgctacgtagcataa

DBGET integrated database retrieval system