KEGG   Shewanella sp. ANA-3: Shewana3_0427Help
Entry
Shewana3_0427     CDS       T00428                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
shn  Shewanella sp. ANA-3
Pathway
shn00010  Glycolysis / Gluconeogenesis
shn00020  Citrate cycle (TCA cycle)
shn00620  Pyruvate metabolism
shn01100  Metabolic pathways
shn01110  Biosynthesis of secondary metabolites
shn01120  Microbial metabolism in diverse environments
shn01130  Biosynthesis of antibiotics
shn01200  Carbon metabolism
Module
shn_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:shn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Shewana3_0427
   00020 Citrate cycle (TCA cycle)
    Shewana3_0427
   00620 Pyruvate metabolism
    Shewana3_0427
Enzymes [BR:shn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Shewana3_0427
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H HlyD_D23 RnfC_N Peptidase_M23 PYNP_C HlyD_3 DUF4813
Motif
Other DBs
NCBI-ProteinID: ABK46670
UniProt: A0KSA1
Position
487935..489941
Genome map
AA seq 668 aa AA seqDB search
MAELKEVFVPDIGGDEVQVIEICASVGDTLAAEESILTVESDKATMDIPAPFAGVLAELK
VAVGDKVSEGTLIAMMQAAGTANVQAAPVAQAAAPAPAPAAPAPVQAAPAPVAAAPATGA
TQVVEVTVPDIGGDTDVSVIEVLVAAGDKIEVDAGLITLETDKATMDVPSPFAGVVKEVK
VAVGDKVSQGSLVIMLEVGGAAPAAAAPQASASAPVAQAAPAAAVAPVAAAPVVAVKEIQ
VPDIGDASNVDVIEVLVSVGDMITADQGLITLETDKATMEVPAPFAGKLLSLTVKVGDKV
SQGSVIATIETVTAGAAPAPQAAAPAPVAQEAAPAPVAAAPSRPPVPHHPSAGAPVATGV
VHASPAVRRLAREFGVDLTQVTGSGRKGRIMKEDVQAYVKYELSRPKATAATSVAAGNGG
GLQVIAAPKVDFSKFGEVEEIPLSRIQKISGPNLHRNWVTIPHVTQFDEADITEMEEFRK
QQNDAAAKKKADYKITPLVFMMKAVAKTLQQFPVFNSSLSSDGESLIQKKYYHIGVAVDT
PNGLVVPVVRDVDKKGIIELSRELADISIRARDGKLKSADMQGSCFTISSLGGIGGTAFT
PIVNYPDVAILGVSKSEIKPKWNGKEFEPKLMLPLSLSYDHRVIDGAMAARFSVTLSGIL
SDIRTLIL
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atggctgaattaaaagaagtttttgttcctgatatcggcggcgatgaagtacaggttatc
gaaatctgtgcttctgtgggcgataccttagcagcggaagagtcgattctgaccgttgaa
agcgacaaggcgaccatggacattcctgcgccgttcgcgggtgtgttagccgaattgaaa
gtggccgtcggtgacaaagtcagcgaaggtaccttaattgcgatgatgcaagcagcgggc
acggctaatgttcaagctgcaccggttgctcaagctgccgctcctgcgccagcaccagca
gcacctgctccagtacaagcggctcctgcccctgtggctgccgcgccagccacgggtgca
acccaagtggttgaagtcactgtgccggatatcggtggtgacacagatgtgtctgttatc
gaagtcttagttgccgctggcgataagattgaggtggacgctggccttatcacgcttgaa
accgacaaagcgaccatggacgtaccatcgccattcgcgggtgtggtaaaagaagtgaaa
gtggctgtgggtgacaaggtttctcaaggctccttagtgatcatgctcgaagtgggtggc
gcagctcctgctgccgctgctccacaagcaagcgcgtcagctcctgtcgctcaagctgca
cctgcggcggctgttgctccagtagctgctgcaccagtggttgcggttaaagaaatccaa
gtgccagatattggtgatgccagcaatgtcgatgtgatcgaagtgctagtgtctgtgggt
gatatgatcactgctgaccaaggtttgatcacgttagaaaccgataaagcgaccatggaa
gtgcctgcgccattcgccggtaaactgttgtcgttaaccgttaaagtcggtgataaggtt
tctcaaggtagcgtgattgcgacgattgagactgtgactgctggtgcagctcctgcgcct
caagccgcagcacctgcacctgtcgcccaagaagcggcaccagcacctgttgcagccgcg
ccgagccgtccaccggttccacatcacccaagtgcgggtgcgccagtggcaaccggtgtg
gtgcatgcgtctcctgcggttcgccgtttggcccgtgagtttggtgtggatctcactcaa
gtgacgggttctggccgtaaaggtcgcatcatgaaggaagacgtacaggcgtatgtgaag
tacgaactgtctcgtcctaaggcgacagcagcaacttcagttgcagcgggtaacggtggt
ggtctgcaagtgattgctgcaccgaaagtggatttcagcaagtttggtgaagtggaagaa
attccattaagccgtatccagaagatctctggtccaaacctacaccgtaactgggtaact
attcctcacgtgactcagttcgatgaagctgatatcaccgaaatggaagagttccgtaag
cagcagaacgacgcggcggcgaagaagaaagccgattataagatcactccgctggtcttt
atgatgaaagctgtggcgaaaacgctgcaacaattccctgtgttcaactcaagcttaagc
agcgacggtgaatcactgatccagaagaagtactaccacatcggtgtggcggtggatacg
ccaaacggtctagtggttcctgtggtacgtgatgtggataagaaaggcattatcgagtta
tctcgtgagttggccgatatttctatccgcgcccgcgatggtaagctgaagtctgccgat
atgcagggtagctgcttcactatttcaagcctaggtggcattggtggtactgcatttacc
ccaatcgttaactacccagacgtggcgattttaggtgtgtctaaatctgaaattaagcct
aagtggaatggtaaagaattcgagcctaaattgatgttgccactgtcgctatcatacgat
caccgcgtgatcgatggtgctatggctgcacgctttagcgtgaccctgtcaggaattctg
tccgatattcgtactttgattctgtaa

DBGET integrated database retrieval system