KEGG   Shewanella sp. ANA-3: Shewana3_1026Help
Entry
Shewana3_1026     CDS       T00428                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
shn  Shewanella sp. ANA-3
Pathway
shn00010  Glycolysis / Gluconeogenesis
shn00051  Fructose and mannose metabolism
shn00562  Inositol phosphate metabolism
shn01100  Metabolic pathways
shn01110  Biosynthesis of secondary metabolites
shn01120  Microbial metabolism in diverse environments
shn01130  Biosynthesis of antibiotics
shn01200  Carbon metabolism
shn01230  Biosynthesis of amino acids
Module
shn_M00002  Glycolysis, core module involving three-carbon compounds
shn_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:shn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Shewana3_1026
   00051 Fructose and mannose metabolism
    Shewana3_1026
   00562 Inositol phosphate metabolism
    Shewana3_1026
Enzymes [BR:shn01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Shewana3_1026
Exosome [BR:shn04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Shewana3_1026
  Exosomal proteins of bladder cancer cells
   Shewana3_1026
  Exosomal proteins of melanoma cells
   Shewana3_1026
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ABK47261
UniProt: A0KTZ2
Position
1198659..1199441
Genome map
AA seq 260 aa AA seqDB search
MALRRPMVAGNWKMNGSAALAQELFKKFASKLQNDSAEVVLCPPSIYLESVRQLLEANKE
ALDGSLVRMGAQNLSQHDFGAYTGEVSGQMLKDCGCRYVIIGHSERRRMYGETSNIVAEK
FAAAQKHGLTPILCVGESGPAREARRTFEVIAEELDIVIQKNGTMAFDNAIIAYEPLWAV
GTGKSATPEQAQEVHAFIRKRLSEVSPFIGENIRILYGGSVTPSNAADLFAQPDVDGGLI
GGASLNSTEFLSLCTIAMSA
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggcactcagacgtcctatggtagctggcaattggaagatgaacggcagcgcggcatta
gcccaagagttgttcaagaaatttgcctcaaagctccaaaatgattcagctgaagtggtt
ttatgcccgccttctatctatctagaaagcgtaaggcaactgctagaagcaaacaaggaa
gcgttagacggttcacttgttaggatgggcgctcagaatttaagtcaacatgactttggc
gcttataccggagaagtttcgggtcagatgcttaaagattgcggatgtcgatatgtcatt
atcgggcattcagaacgtcgccgtatgtacggagagacgagtaatatcgtagcggagaaa
ttcgctgcagcacaaaagcacggtttaacccccattttatgcgtgggtgagtcgggtcca
gcacgtgaagcaagacgtaccttcgaggtgattgcggaagagttggatatagtgatccag
aaaaatggcactatggcttttgataacgccattatcgcttacgagccgttatgggcggta
gggactggtaagagcgcgacaccagagcaggcacaagaagtacatgcgtttatacgcaag
cgtctctctgaagtgtctccgtttatcggagaaaatatcaggattttgtacggtggcagt
gtgacaccgagtaatgcggcagatttatttgcccaacctgatgttgatggtggactgatt
ggcggtgccagtttaaactctaccgagtttttaagtctgtgtaccatagcgatgagcgca
taa

DBGET integrated database retrieval system