KEGG   Shewanella sp. ANA-3: Shewana3_1197Help
Entry
Shewana3_1197     CDS       T00428                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
shn  Shewanella sp. ANA-3
Pathway
shn00480  Glutathione metabolism
shn00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:shn00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Shewana3_1197
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Shewana3_1197
Enzymes [BR:shn01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Shewana3_1197
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: ABK47432
UniProt: A0KUG3
Position
1404235..1404846
Genome map
AA seq 203 aa AA seqDB search
MISILVSDVIENNEFANLGAPNEKDIMMKLPLVIFASLLSTSAFAATCPSYLDVEVRKLH
SDEKINLCELTQGKPVLLVNTASNCGYTPQFKALEALHKEYKDKGLVVIGFPSDDFFQEE
NDEKDTAKVCYINYGVTFTMLATSPVRGSDANSVFKYLGDKADSPKWNFYKYVVSGDGNT
VQQFNSKVKPDSAELKQAIESVL
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgatctctatattagtgagtgacgtaatagagaataacgagtttgccaatcttggcgcg
cccaatgagaaggacattatgatgaaactccccttagttatctttgccagcctgttaagc
actagcgcatttgcggcaacttgcccgagttatcttgatgttgaagtgcgtaaattacac
tcggatgagaagattaatctgtgtgaattgactcagggcaagccagtgttactggtcaac
accgcgagtaactgtggttacactccgcaatttaaggccctcgaagcgctccataaagaa
tacaaagacaaaggcttagtggtgattggtttcccttccgatgactttttccaagaagaa
aatgatgaaaaagacacggctaaggtgtgctacatcaactatggtgtcacctttactatg
ctcgctacatcgcccgtgagaggcagcgatgctaacagtgtcttcaaatacttaggagat
aaagccgactcgcctaagtggaacttctacaagtatgtcgtcagtggcgatggcaatact
gtgcagcagtttaattctaaggttaaacccgatagcgccgagcttaagcaggcaatagaa
tcagtgctttaa

DBGET integrated database retrieval system