KEGG   Shewanella sp. ANA-3: Shewana3_1246Help
Entry
Shewana3_1246     CDS       T00428                                 

Definition
(GenBank) transcriptional regulator-like protein
  KO
K07726  putative transcriptional regulator
Organism
shn  Shewanella sp. ANA-3
Brite
KEGG Orthology (KO) [BR:shn00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:shn03000]
    Shewana3_1246
Transcription factors [BR:shn03000]
 Prokaryotic Type
  Helix-turn-helix
   Other families
    Shewana3_1246
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_31 HTH_3 HTH_19 HTH_28 MqsA_antitoxin YdaS_antitoxin HTH_37
Motif
Other DBs
NCBI-ProteinID: ABK47481
UniProt: A0KUL2
Position
1460354..1460659
Genome map
AA seq 101 aa AA seqDB search
MTSKIIESLRGDLDALHNAGAISKVTMREFDEICPPPVREFSADDIKRLREGLHFSQPVF
AHHLHTTASTVRKWEQGETRPAGPALKLLNVIADKGLQAII
NT seq 306 nt NT seq  +upstreamnt  +downstreamnt
gtgacgagcaaaatcattgaatccctgcgcggtgacctggacgcattgcacaacgctggc
gcaatcagcaaggtgacgatgcgcgagtttgacgagatctgtccgccgccagtacgcgag
ttcagtgctgacgacattaaacgtctgcgtgagggactgcacttcagtcagccagtgttc
gctcatcatctgcacaccaccgcctcgacggtgcgcaagtgggaacaaggcgaaacgcgt
ccagccggtcctgcgctcaagctgcttaatgtcatcgccgacaaaggcttgcaggccatt
atctga

DBGET integrated database retrieval system