KEGG   Shewanella sp. ANA-3: Shewana3_1247Help
Entry
Shewana3_1247     CDS       T00428                                 

Definition
(GenBank) conserved hypothetical protein
Organism
shn  Shewanella sp. ANA-3
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hypoth_Ymh
Motif
Other DBs
NCBI-ProteinID: ABK47482
UniProt: A0KUL3
Position
1460685..1461503
Genome map
AA seq 272 aa AA seqDB search
MASQIAPFSSQHLEAACRVLADTAQGLTGTQIGRLLQETQVADPSPDMTKWKRLFNALAG
AQNQHQVGNHLIMFINRAMNPVSYASDPGTFAWRRDELNVVLAFSGFYVREDGKVGYADK
ANTLDEARARAGRLKAALESRAVHVEVLNYCRVELMDENYFHAVFEATKGVAERIRQLSG
LSGDGADLVNKAFGGQQPVLVLKALSTESEKSEQKGFVNLLIGLFGAVRNPLAHAAKTNW
PMSEQDALDILTLVSLIHRKLDGATRLTAVSA
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
gtggcgtcacaaattgccccattcagttctcagcacctggaagctgcctgccgcgttctt
gccgatacggcacaaggtctgaccggcacgcaaatcgggcgtttgttgcaagaaacccag
gtagccgacccctcaccagatatgaccaagtggaaacggctgttcaatgcgttggcaggc
gctcagaaccagcatcaggttggcaaccatctcatcatgttcatcaatcgcgcgatgaat
ccggtgagttacgcaagcgatcccggaacatttgcttggcgccgtgatgaactcaatgtt
gttttggcgttctcgggtttctacgtgcgtgaagatggcaaagtcggatatgccgataag
gccaatacgctggacgaagcccgtgcacgagccgggcgactcaaggcggcgctggaaagt
cgcgctgtacatgtagaagtcctgaactactgtcgcgtagaactcatggacgagaactat
tttcacgcggtatttgaagcgaccaagggcgttgccgagcggattcgccagctctcgggg
ctgagtggcgatggtgctgaccttgtgaataaggcatttggcggtcagcaacctgtactt
gtcttgaaggcgctgagtacggagtctgaaaaaagcgagcagaaaggctttgtgaacctg
ctgatcggtctgtttggagcggtacgcaatccgcttgcccatgccgcgaaaacgaattgg
cctatgtccgaacaggacgccttggacatcctgacgctggtatcgctgattcatcgtaag
ttggatggcgccacgagactaactgccgtatcggcgtaa

DBGET integrated database retrieval system