KEGG   Shewanella sp. ANA-3: Shewana3_1267
Entry
Shewana3_1267     CDS       T00428                                 
Name
(GenBank) TraF peptidase. Serine peptidase. MEROPS family S26C
Organism
shn  Shewanella sp. ANA-3
SSDB
Motif
Pfam: Peptidase_S26
Other DBs
NCBI-ProteinID: ABK47501
UniProt: A0KUN2
Position
1480079..1480666
AA seq 195 aa
MTAASTAGPASRSRSRLSVHILLIVLSVCGLAALAWASFVQPLPRLIYNPSDSVAVGWYR
LDPLHHPSDSLSHRAEVGSIVLTTLPPETAVLAAQRGYLPDHIPLLKRVGAVAPQHVCIS
ADQVRIDGVPVAALLHTDRLGRELQAWPHCRQLQPGELFLLSVTNPASFDSRYFGPVSVS
AVIGIASPVWLEKRQ
NT seq 588 nt   +upstreamnt  +downstreamnt
atgaccgctgcttctactgctggccccgcatcgcgttctcgctcgcgcctgagcgtgcac
atcttactgatagttctttccgtctgcggcttggctgcattggcttgggcgtccttcgtg
cagccgttgccacgcctgatctacaacccgtctgacagcgtggcagtaggctggtatcgc
ctcgatccgctgcaccacccctccgactcgctatcacatagggcggaagtcggcagcatc
gtcctgaccacattgccgccagaaacggctgtgctcgccgcgcagcgtggttacctgcca
gaccacattccattgctgaaacgtgtgggtgcagtcgcaccacaacatgtatgcatttcg
gccgatcaggtacgcatcgacggtgtaccggtggccgctctgttgcacaccgatcggctt
ggccgggagctgcaagcctggccgcactgccgacagcttcaacctggcgaactgttcctg
ttgagtgtgaccaacccggcgtcgtttgacagccgctatttcggcccggtcagcgtgtcc
gccgtgatcggtattgcgagccctgtttggctggagaaacgtcaatga

DBGET integrated database retrieval system