KEGG   Shewanella sp. ANA-3: Shewana3_1268Help
Entry
Shewana3_1268     CDS       T00428                                 

Definition
(GenBank) conserved hypothetical protein
Organism
shn  Shewanella sp. ANA-3
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3363 MobL
Motif
Other DBs
NCBI-ProteinID: ABK47502
UniProt: A0KUN3
Position
1481079..1483052
Genome map
AA seq 657 aa AA seqDB search
MSDYHDDDFRIRPNAPKHRGQGFVSKVLKQTGKASGGKSSARRQTSAGSAGQRPGSRLGR
GHTAARFTGSSLTPFSRRVTIKTLLVNQRRASPQSLGKHLRYIERDGAGRNGEPGRAYGP
QIDEADLDAFKERCQGDRHHFRFILSPEDGAELGDLRTYTRHLMSRMEADLGTQLDWVAV
DHWNTDNPHTHLVVRGRDDTGKDLIIAGDYIAHGFRHRAAELATEWLGRRTELEIQQTLR
REVEQERWTSLDRTLQREAGDDHRVQIERFIDPALQRQRQLLIGRLQHLQRLGLADEIQP
GTWNIHADAEKTLRALGERGDIIRTLQRSMSGLSRELTVFEPGESGRSVIGRVAGKGLAD
ELRDRGYLVIDGVDGKAHYISLNTSDELTNYPTGAVVEVRCSAELRSADRNIAELASDGL
YRTDHHLVIEQGRTKAGRDPQEIVAAHVRRLEALRRVGIVERVAEGLWKVPGDLPERGRQ
YDTQRLGGVAVELKSHLPIERQARVIGATWLDQQLIGGGRGFSDIGFGGEVKEALQERAD
FLEEQGLAHRRGLGVILARNLLATLRNRELARAAQDIVADTGLEHRPVADGQRVAGIYRR
NVMLASGRYAMLDDGMGFSLVPWKPVIEQRLGQQIAATVRGGGVSWEIGRQRGPTIA
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
atgagtgactaccacgatgatgattttcgtatccgtcccaatgcgccaaagcaccgggga
cagggctttgtttccaaagtgctcaagcagacaggcaaagccagtgggggcaaatcctcg
gcacgccgtcagacatcggcgggtagcgctggccagcggcccggctcacgtttggggcgt
ggccataccgccgcacgctttacgggctcttcactgacgccgttctcgcgccgtgtcact
atcaaaaccctgctggtcaatcagcgccgggctagcccgcagtcgctggggaagcacctg
cgctatatcgagcgcgacggagcggggcgtaatggtgagccaggccgagcctatgggccg
cagatcgacgaggccgatctcgacgctttcaaggaacgctgtcagggcgaccggcaccat
ttccgtttcatcctttcgcccgaggatggagctgagctaggtgatctacgcacttacaca
cgtcatctgatgagccggatggaagctgatctaggcacgcagctggattgggtggcagtg
gatcactggaatactgacaacccacacacgcatctggttgtgcgtgggcgtgacgacact
ggcaaagacctcatcatcgccggcgactacatcgcccacggcttccgccatcgcgccgcc
gaactggcgacggaatggctggggcggcgcactgaactggagatccagcagaccttgcga
cgcgaggtggaacaggagcggtggacgagcctggatcgcacgctgcaacgagaggctggc
gatgaccaccgggtgcagatcgaacgctttatcgacccggcgttgcaacgtcagagacaa
ctgctcattggtcgcttgcaacacttgcagcgcctgggcttggcggacgagatacagccc
ggcacctggaacattcacgccgatgctgagaagacattgcgtgccctgggtgaacgtggc
gatatcatccgcaccctgcaaaggtccatgagcggcctttcacgagaactgaccgtcttt
gaaccgggtgagagcgggcgcagtgtcatcgggcgtgtggctggtaaaggactcgccgat
gagctgcgcgaccggggttatttggtgattgacggcgtggatggcaaggcccattacatt
tcactcaacaccagtgacgagttgacgaactatcccaccggggccgtggtggaagtgcgc
tgttctgctgaactacgttcggccgaccgcaacatcgcggaactggcaagcgacggcctg
taccgcacagaccatcacctagtcatcgaacaaggccgaaccaaggctgggcgcgaccca
caagaaatcgtcgcagcccatgttcgtcgcctggaagcgttacgtcgtgtgggcattgtg
gagcgcgtggccgaggggctatggaaggtgccgggcgacctgcctgagcgtgggcgtcag
tatgatactcagcgtctgggcggtgtggcggtggagctgaaatcgcacctgcccatcgaa
cgtcaggcgcgcgtgatcggcgctacttggcttgaccagcaactaatcggcggtggtcga
ggattcagtgacataggctttggtggagaggtgaaggaagcgttgcaggaacgagccgac
ttcctcgaagaacaggggctggcccatcgacgcgggctgggtgtgatcctggcgcgcaac
ttgttggcgacgctgcgcaatcgggaactggcacgagccgcgcaggacattgtcgccgat
accggcctggagcatcgccccgtggccgatgggcagcgcgtggcggggatctaccggcgc
aacgtcatgcttgccagtggacgctacgccatgctcgatgacggtatggggttcagcctg
gtgccgtggaagccggtgatcgagcagcggctgggtcagcagatcgccgcgactgtacgt
ggtggtggggtgtcgtgggagattgggcggcagagagggccaaccatcgcttag

DBGET integrated database retrieval system