KEGG   Shewanella sp. ANA-3: Shewana3_1282
Entry
Shewana3_1282     CDS       T00428                                 
Name
(GenBank) type II secretion system protein E
  KO
K20527  type IV secretion system protein TrbB [EC:7.4.2.8]
Organism
shn  Shewanella sp. ANA-3
Pathway
shn02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:shn00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Shewana3_1282
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:shn02044]
    Shewana3_1282
Enzymes [BR:shn01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     Shewana3_1282
Secretion system [BR:shn02044]
 Type IV secretion system
  Trb secretion system protein
   Shewana3_1282
SSDB
Motif
Pfam: T2SSE TrwB_AAD_bind AAA_16 FtsK_SpoIIIE Zeta_toxin AAA_28 AAA_30 IstB_IS21 ABC_tran MMR_HSR1 AAA_7 ATPase DEAD AAA_25 CbiA Sigma54_activat ResIII Phosphatase MobB AAA_29 AAA_19 AAA_10 GTP_EFTU TsaE CLP1_P
Other DBs
NCBI-ProteinID: ABK47516
UniProt: A0KUP7
Position
1493533..1494603
AA seq 356 aa
MSAVPQIPPQPRSSAATSLDRRIQMLRTAMGPLIATALEDPDVVEIMLNPDRTLWVDRLS
SGRAPLGVELPEADGERIIRLVAAHVGAEVHRGQPLLTAELPETGERFEGILPPAAPGPA
FALRKRAVNIIGLDQYVADGILTAGQADFLRRAVRERQNVLIAGGTSTGKTTLANALLAE
IAATGDRVLVLEDTIELQCAARDHVPLRTRAGVVSMQELVRATMRLRPDRVVVGEVRGGE
ALDLIKVWGTGHPGGIATIHAGSALGALLRLEQLILEVAVNPPRALIAEAVNVVIHIAGR
GRKRHVETIARVVGFDGTGYRLADALETPFPELIPLPLAADAAALPPSPDQPGELP
NT seq 1071 nt   +upstreamnt  +downstreamnt
atgagcgccgttccgcagatcccgcctcaacctcgttcgtccgccgcaacctcactggat
cgacgaatccagatgctgcgcacggcaatggggccgctgattgccaccgcgctcgaagac
ccggacgtggtggaaatcatgctcaaccccgaccgcaccctatgggtggatcggctgtcg
tcgggccgcgcaccgctgggcgtggaactgcccgaagccgatggcgaacgcatcatccgc
ctggtggctgcgcacgtcggtgcggaagtgcatcgcggccagccgctgctaaccgccgag
ctgccggagacgggcgaacgcttcgagggcatcttgccgccagccgctcccggcccggcc
ttcgcgctgcgcaagcgtgccgtgaacatcatcggcctggatcagtatgtggccgacggc
atcctgaccgctggccaggcggacttcctgcgccgcgccgtgcgcgagcgccagaacgta
ctgatcgccggcggcaccagtaccggcaagaccaccctcgccaacgctttgctggccgag
atcgccgccaccggcgaccgcgtgctggtgctcgaagacaccatcgagctgcaatgcgca
gcccgtgaccatgtgccgctgcgcacccgtgcgggcgtggtgtcgatgcaggaactggtg
cgcgccacgatgcgcctgcgcccggatcgcgtcgtcgtcggcgaagtacgcggcggcgaa
gccctcgacctcatcaaagtgtggggaacaggccaccccggcggcatcgccaccatccac
gccggttccgcgctaggcgctttgctgcgcctcgaacagttgatcctcgaagtcgcagtg
aatccgccacgggcgctgatcgccgaggcggtcaacgtcgtcatccacatcgccggacgt
ggccgcaagcgccacgtcgaaaccatcgcccgtgtcgtcggcttcgacggcaccggctat
cgcctggcggacgcgctggaaacgccgtttcccgaattgatcccgcttccgctcgcagcc
gacgccgctgcgcttcccccgtcccctgaccaacctggagaactgccatga

DBGET integrated database retrieval system