KEGG   Shewanella sp. ANA-3: Shewana3_1285
Entry
Shewana3_1285     CDS       T00428                                 
Name
(GenBank) AAA ATPase
  KO
K20530  type IV secretion system protein TrbE [EC:7.4.2.8]
Organism
shn  Shewanella sp. ANA-3
Pathway
shn02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:shn00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Shewana3_1285
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:shn02044]
    Shewana3_1285
Enzymes [BR:shn01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     Shewana3_1285
Secretion system [BR:shn02044]
 Type IV secretion system
  Trb secretion system protein
   Shewana3_1285
SSDB
Motif
Pfam: CagE_TrbE_VirB P-loop_TraG HerA_C AAA_10 TraG-D_C AAA_22 Zot CbiA AAA_16 ABC_tran
Other DBs
NCBI-ProteinID: ABK47519
UniProt: A0KUQ0
Position
1495263..1497713
AA seq 816 aa
MLNLAEYRQRPALLADWLPWAGLIAPGVVLNKDGSFQRTARFRGPDLDSATQGELIAASA
RLNNALRRLGSGWALFIEAERRPAAGYPHSDFPEPLSWLVDEERRAAFEESGHHFESGYH
LTMVFLPPEESRARAAKLLYENSPGDGVDWRGRLDAFVAETDRVFDLLDGVMPEIAWLDD
DDTLTGLHATVSTRRYRLGVPEVPFHIDALLADCALVGGLAPMLGDQHLRVVSVRGFPTS
TWPGILDDLNRLGFGYRWSTRFLCMDKAEAEKELGRLRRQWFAKRKNVVALLRETIFQQE
SPLVDTDASNKAADADAALQELGSDQVAFGYLTATVTVLDADPAVADEKLRMVERVIQGR
GFVTIPETLNAVDAWLSSIPGNAYANVRQPIFSTLNLAHMMPLSAVWAGPEKNDHLDGPP
LIVTRTDGATPFRLVTHIGDVGHTLVAGPTGMGKSVLLAILAMQFRRYFGSRIFAFDMGR
SMRATILGLGGEHYDLGADGGIAFQPLARIDSEGYRTWAAEWVEGRLLHEGVTVGPDEKA
AIWSALGSLAGAPVEQRTLTGLSVLLQSNALRQALSPYVLGGAHGKLLDADRDRLGMADV
QGFEMEELMHSPAAVQAVLRYLFARFDERFDGAPTLLILDEAWLFLDEPSFAARIRQWLK
TLRKKNVSVIFATQSLADIKDSTIAPAIIESCASRIFLPNPQATEPQIRTIYEGFGLNSR
QIEIVATAQPKRDYYYQSRLGNRLFDLDLGPLALAFAGASTPQDQRDIDRVLTQAGAPGF
TGAWLRHRGLDWAADLLPSSPAAASFLNSQPLEVSP
NT seq 2451 nt   +upstreamnt  +downstreamnt
atgctgaaccttgccgaataccgccagcggcccgcgctgctggccgactggcttccctgg
gccgggctgatcgcgccgggcgttgtgctgaacaaggatggctctttccagcgcacggca
cgttttcgcgggccggacttggacagcgccacgcaaggcgagttgatcgccgcatccgcg
cggctcaacaacgcgctgcgccgcctgggttcgggctgggccttgttcatcgaggccgag
cgccgaccggctgcgggctatccgcactcggattttcccgagccgctgtcctggttggtg
gacgaggaacgccgcgccgccttcgaggaatcgggccatcacttcgagagcggttatcac
ctgacgatggtgtttctcccgccggaggaatcgcgcgcccgcgctgccaagctgctctac
gagaactcgcccggcgacggcgtggactggcgtggtcggctcgatgccttcgtggctgaa
accgatcgcgtgttcgatctgctcgatggcgtgatgccggaaatcgcctggctcgatgac
gacgacacgctgaccggcctgcacgcgacggtttcgacgcggcgctaccggctcggcgta
cccgaagtaccgttccatatcgacgcgctactggccgactgcgccctggtcggtggcctt
gcgccgatgctgggcgaccagcacctgcgggtggtgtcggtgcgtggctttccgacctcg
acctggccggggattctggacgacctcaaccgcctgggctttggctaccgctggagcaca
cgctttctctgcatggacaaagccgaggccgaaaaggaactcggccgcctgcgccgccag
tggttcgccaagcgcaagaacgtcgtcgcactgctgcgcgaaacgatcttccagcaggaa
agcccgctggtggataccgacgccagcaacaaggccgccgacgccgatgcggccttgcag
gagttgggcagcgatcaagtcgcgttcggctatctcaccgccacggtgacagtgctcgac
gccgacccggcagtggccgacgagaagctgcgcatggtggagcgcgtcatccagggtcgg
ggcttcgtgacgattcccgaaaccttgaacgcggtcgatgcctggctgtcgtccatcccc
ggcaacgcttacgcgaacgtgcgccagcccatcttctcgacgctgaacctggcgcacatg
atgccgctgtcggcggtgtgggccgggccggagaagaacgaccatctggacggcccgccg
ctgatcgtcacccgcaccgatggcgcgacgccttttcgcttggtcacgcacatcggcgac
gtgggccacacactggtcgccgggccgaccggcatgggcaagtcggtactgcttgccatt
ctggccatgcagttccggcgctacttcggctcgcggatcttcgccttcgacatgggccgc
tccatgcgtgccaccatcctcggcctcggcggcgaacactacgacctcggcgccgatggc
ggcatcgcctttcagccgttggcccgtatcgacagcgagggctaccgcacctgggcggct
gaatgggtggaaggccggctactgcacgaaggcgtgaccgtcggccccgacgagaaggca
gccatctggtcggcgctgggtagcctcgccggtgcgccggtggaacagcgcacgctgacc
gggctttccgtgctgctgcaatcgaacgcgctacggcaagcgctgtcgccctatgtgctt
ggcggcgcccacggcaagctgctggacgccgaccgcgaccggctgggcatggccgacgtg
cagggcttcgagatggaagaactgatgcacagccccgccgccgtgcaagcggtgctgcgc
tacctgttcgcccgcttcgatgagcgtttcgatggtgcgcccacgctgctgattctggat
gaagcctggctgttcctcgatgagccatctttcgcggcccgcatccggcaatggctcaag
acgctcaggaaaaagaacgtcagcgtcatcttcgccacgcagagcctggcagacatcaag
gactcgaccatcgcgcccgcgatcatcgagagctgcgccagtcggattttcttgcctaac
ccgcaggcgaccgagccgcagattcgcacgatctatgagggtttcgggctcaacagccgg
cagatcgagatcgtcgccaccgcgcagcccaagcgcgactactactaccagtcgcgtctc
ggcaaccgcctattcgacctcgacctggggccgttggcgctcgccttcgcgggcgcatcc
acccctcaagaccaacgcgacatcgaccgcgtgttgacgcaggccggcgcccccggcttc
accggcgcgtggctgcgccatcgcggcctcgactgggccgccgacctgctgccgtcctca
ccggcggccgcttcgtttctcaactcccaaccactggaggtttcaccatga

DBGET integrated database retrieval system