KEGG   Shewanella sp. ANA-3: Shewana3_1288
Entry
Shewana3_1288     CDS       T00428                                 
Name
(GenBank) TrbL/VirB6 plasmid conjugal transfer protein
  KO
K07344  type IV secretion system protein TrbL
Organism
shn  Shewanella sp. ANA-3
Pathway
shn02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:shn00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Shewana3_1288
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:shn02044]
    Shewana3_1288
Secretion system [BR:shn02044]
 Type IV secretion system
  Trb secretion system protein
   Shewana3_1288
SSDB
Motif
Pfam: TrbL CoA_binding_3
Other DBs
NCBI-ProteinID: ABK47522
UniProt: A0KUQ3
Position
1498780..1500162
AA seq 460 aa
MNDVTIIDRFLDTFSRYIDSGFGLLQGEVAFLTATLIVIDMTIAGLYWAMSHATGQGEDV
IAKLLRKVLYVGAFAYIIGNFNWLASIVFRSFAGLGITATGSAITMENFLQPGRLAKTGI
DAGAPILEQIGDMAGFPEVFVNIDPIVVMFLAWLVVILCFFVLAVQLFITLIEFKLTTLA
GFVLVPFALWNKTSFLAEKVLGNVVSSGIKVLVLAVIVGIGSGLFAEFQAHPDEPSIDHA
LVVMLASLALLALGIFGPGIATGLVSGAPQLGAGAMAGAAVGAVGTGVAIGAAATGVGAA
VAAGARMAPAAAKLAGAGARAATSAAGNARSAFQAGSTAAGGGAKGAAAGLGNVAKTSAQ
AASRRVASGASAAGQKMTSSFRAGWNGSSDDAGAAAAGQSAASEAADGAANSQKQEQPAW
AKRMHRRQQITHAATTTAHTLRGGDGGGSGQGPSLRDSDT
NT seq 1383 nt   +upstreamnt  +downstreamnt
atgaacgacgtgaccatcatcgaccgtttcctcgatacgttctcgcgctacatcgactcg
ggcttcgggctgctacaaggcgaagtggcgtttctcaccgccacgctcatcgtcatcgac
atgacgatcgcgggactgtactgggccatgagccacgccaccggccagggcgaggacgtg
atcgccaagctgctgcgcaaggtgctctacgtcggcgccttcgcctacatcatcggcaac
ttcaactggctggcgagcatcgtgttccgctcgttcgccggcctgggaatcacggccacc
ggatcggccatcacgatggagaattttcttcagccggggcggctggcgaaaaccggcatt
gacgcaggagcaccgattctggaacagatcggggacatggccgggttccccgaggtgttc
gtgaacatcgaccccatcgtggtgatgttcctcgcctggctggtggtgatcctctgcttc
ttcgtgctggcggtgcagcttttcatcacgctgatcgagttcaagctgaccacgctcgcc
ggcttcgtgctggtgccgttcgcgctgtggaacaagacgagcttcctggcggaaaaggtg
ctcggcaacgtggtgtcttcgggcatcaaagtcttggtgctggccgtcatcgtcggcatc
ggttcgggtctgttcgccgagttccaagcgcatcccgatgaaccatccatcgaccatgcg
ctggtcgtgatgctggcctcgctcgcgctgctggcgctgggcatcttcggccccggcatc
gccaccggcctggtgtccggtgcgcctcagcttggcgcgggcgcgatggccggtgctgct
gtcggcgctgtcggcacgggcgtcgccatcggtgccgccgcgaccggcgtgggcgccgcc
gtagccgccggggcacgcatggcgccagccgccgcgaagctggccggtgccggggcgcgt
gccgccacctcagcggctggcaacgcgcggtcggcgttccaggcgggttccaccgctgcg
ggcggcggggccaaaggcgcggcggctggccttggcaatgtcgccaagaccagcgcacag
gccgccagccgccgcgtcgcttctggtgcttccgcagcagggcagaagatgaccagttcc
tttcgtgccggctggaacggatcttcggacgatgccggtgcagccgcggcgggccaatcc
gccgcaagcgaggccgcagacggcgctgccaactcgcagaagcaagagcaacccgcctgg
gccaagcggatgcaccgccgccagcagatcacccatgccgcgaccaccaccgcccacacg
ctgcgcggtggcgacggcggcggctcagggcaaggcccgagcctgcgcgattccgatacc
tga

DBGET integrated database retrieval system