KEGG   Shewanella sp. ANA-3: Shewana3_1552Help
Entry
Shewana3_1552     CDS       T00428                                 

Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
shn  Shewanella sp. ANA-3
Pathway
shn00430  Taurine and hypotaurine metabolism
shn00620  Pyruvate metabolism
shn00640  Propanoate metabolism
shn00680  Methane metabolism
shn01100  Metabolic pathways
shn01120  Microbial metabolism in diverse environments
shn01200  Carbon metabolism
Module
shn_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:shn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Shewana3_1552
   00640 Propanoate metabolism
    Shewana3_1552
  09102 Energy metabolism
   00680 Methane metabolism
    Shewana3_1552
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    Shewana3_1552
Enzymes [BR:shn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     Shewana3_1552
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: ABK47786
UniProt: A0KVG7
Position
complement(1808697..1809896)
Genome map
AA seq 399 aa AA seqDB search
MSNKLVLVLNCGSSSLKFAVIDAQTGDDQISGLAECFGLEDSRIKWKINGEKHESSLGAF
TAHREAVEFIVNKILAGQPELAAQIQAVGHRIVHGGEKFTRSVIIDEHVIKGIEECSSLA
PLHNPAHLIGIRAAIASFPKLPQVAVFDTAFHQSMPERAYIYALPYKLYREHGIRRYGMH
GTSHLFVSREAAKVLNKPLEETNVICAHLGNGASVTAVKGGKSVDTSMGLTPLEGLVMGT
RCGDLDPSIIYHLVHQLGYTLEEVNNLMNKQSGLLGISELTNDCRGIEEGYADGHKGATL
ALEIFCYRLAKYIASYTVPLGRLDAVVFTGGIGENSDIIREKVLNMLQIFNFHVDSERNK
AARFGKKGIITTDNSTVAMVIPTNEEWVIAEDSIKLITK
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgtctaataaactggttttagtactcaattgcggtagctcttcactcaaatttgccgtc
attgacgcgcaaacaggtgacgatcagatctctggcctagccgagtgttttggcttagaa
gactcgcgcattaaatggaaaatcaacggtgaaaagcatgaatcctctttaggtgcattt
accgctcaccgcgaagccgttgaatttattgtcaataaaatccttgctggtcaacctgaa
ttagccgcgcagatccaagccgtgggtcaccgtatcgtacacggcggtgagaagttcact
cgctctgtgatcatcgacgagcatgtgatcaaaggtattgaagaatgttcttcactggcg
ccactgcataacccagcacaccttatcggtattcgcgcggccattgcatctttccctaaa
ctgccacaagtggcggtattcgatactgcattccaccaaagcatgcctgagcgcgcgtac
atctacgctctaccatacaagctgtaccgtgagcatggtattcgccgttatggtatgcac
ggcactagccacctgtttgtgagtcgtgaagccgctaaagtgttgaacaaacctttagaa
gaaaccaatgtgatctgcgcgcatttaggtaacggcgcctcggtgactgcggttaaaggc
ggtaagagcgttgatacctcaatgggactgacgccgcttgaaggtttagtcatgggtact
cgctgtggcgatctcgacccctctatcatctaccacttagtgcaccaactgggttacaca
ctggaagaagtcaacaacctgatgaacaagcaaagtggtctgctagggatttctgagctg
accaacgattgccgtggcatcgaagaaggttatgccgatggtcacaaaggcgcgacctta
gcactggaaatcttctgctaccgtctggcgaaatatatcgcgtcttacactgtgccgctc
ggtcgtttagatgccgtagtctttaccggtggtatcggcgaaaactccgacatcatccgc
gagaaagtgctcaacatgctgcaaatcttcaatttccatgtggatagcgagcgtaacaaa
gcggcccgcttcggcaagaaaggcatcatcaccactgacaacagtaccgttgccatggtc
atcccgaccaacgaagagtgggttatcgccgaagattcgattaaactcattacaaaataa

DBGET integrated database retrieval system