KEGG   Shewanella sp. ANA-3: Shewana3_1707Help
Entry
Shewana3_1707     CDS       T00428                                 

Definition
(GenBank) succinate dehydrogenase subunit D
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
shn  Shewanella sp. ANA-3
Pathway
shn00020  Citrate cycle (TCA cycle)
shn00190  Oxidative phosphorylation
shn00650  Butanoate metabolism
shn01100  Metabolic pathways
shn01110  Biosynthesis of secondary metabolites
shn01120  Microbial metabolism in diverse environments
shn01130  Biosynthesis of antibiotics
shn01200  Carbon metabolism
Module
shn_M00009  Citrate cycle (TCA cycle, Krebs cycle)
shn_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
shn_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:shn00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Shewana3_1707
   00650 Butanoate metabolism
    Shewana3_1707
  Energy metabolism
   00190 Oxidative phosphorylation
    Shewana3_1707
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt
Motif
Other DBs
NCBI-ProteinID: ABK47940
UniProt: A0KVX1
Position
2009604..2009951
Genome map
AA seq 115 aa AA seqDB search
MVTNAASFGRSGVHDFILLRASAVILACYTIFMVGFIACSSPLTYDVWHGLFSALPMKVF
TLLALVALLVHAWIGVWQVLTDYVKCTSLRGVLQFTFVVTVFCYLAAGIVIVWGV
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaaccaatgcagcaagttttggacgcagtggtgttcatgactttattctactacgc
gctagtgcagtaatcctcgcctgttacaccattttcatggttggctttattgcatgtagt
tcccctctcacctatgacgtttggcacggcctgtttagcgctctgccaatgaaagtgttt
accctgcttgcgctagttgcactgcttgttcacgcctggattggtgtatggcaagtattg
acggattacgtcaagtgcacttcgttacgcggtgttttacagttcaccttcgtcgtcacc
gtcttttgttatctggcggccggcattgttattgtgtggggtgtctaa

DBGET integrated database retrieval system