KEGG   Shewanella sp. ANA-3: Shewana3_1750Help
Entry
Shewana3_1750     CDS       T00428                                 

Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
shn  Shewanella sp. ANA-3
Pathway
shn00020  Citrate cycle (TCA cycle)
shn00480  Glutathione metabolism
shn01100  Metabolic pathways
shn01110  Biosynthesis of secondary metabolites
shn01120  Microbial metabolism in diverse environments
shn01200  Carbon metabolism
shn01210  2-Oxocarboxylic acid metabolism
shn01230  Biosynthesis of amino acids
Module
shn_M00009  Citrate cycle (TCA cycle, Krebs cycle)
shn_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:shn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Shewana3_1750
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Shewana3_1750
Enzymes [BR:shn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     Shewana3_1750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH DUF4115
Motif
Other DBs
NCBI-ProteinID: ABK47983
UniProt: A0KW14
Position
2063884..2066109
Genome map
AA seq 741 aa AA seqDB search
MKDNSPTIIYTETDEAPALATLSLLPIIKTFTDAAGVAVETRDISLSGRVIANFPEKLTD
AQKIGDHLAELGELANQPEANIIKLPNISASIPQLKACILELQQKGYDIPNYPDEPKTDE
EKSIKARYDKIKGSAVNPVLREGNSDRRAPLSVKNFAKKNPHSMGKWTKESQSHVAHMSE
GDFYGSEQSVTLANADTVNIVLSQKDGQEVVLKSGLKLLAGEIIDASVMSKKALVSFFER
EIANAKAENVLLSLHLKATMMKVSDPIMFGHAVKVFFKPVFDKHASLFAELGVDVNNGFG
DVYAKIASLPADVRAQIEADIAAVYAERPALAMVDSDKGITNLHVPSDIIIDASMPAAIR
SSGQMWGPDGKLHDTKALIPDRCYAGVYQETIAFCKEHGAFDPSTMGSVPNVGLMAQKAE
EYGSHDKTFEIPADGVVNVIDASGKVLMSHNVEAGDIWRMCQVKDAPIRDWVKLAVRRAR
LSNTPAVFWLDANRAHDAQLIAKVKQYLPEHDTDGLDISIMSPEEATRFSLVRIKEGKDT
ISVTGNVLRDYLTDLFPILELGTSAKMLSIVPLMNGGGLFETGAGGSAPKHVQQVEKEGH
LRWDSLGEFLALAASLEHLSQTVGNPKAQVLADTLDQAIGQFLDSNKSPSRRVGELDNRG
SHFYLAMYWAQALAAQTKDEQLQAHFIPLAHALSANEQVIVAELNNAQGAPVDLGGYYRL
DAAKAEKAMRPSETLNKLLIA
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atgaaagataactcaccaacaattatttataccgaaaccgatgaagcaccagcgctagca
acgctttctctgttacctatcatcaaaacctttaccgatgcggcgggtgttgcggttgaa
acccgtgatatttctttatcgggccgtgtgattgctaatttccctgaaaaactgactgac
gcgcaaaagattggcgatcacttagctgagctgggtgaattagcgaaccaacctgaagct
aacatcatcaaactgccaaacatcagtgcgtcaatcccgcagttaaaagcttgtatttta
gagcttcaacagaaaggttacgacattccaaattatcctgacgagccaaagactgacgaa
gaaaagtctatcaaagcgcgttacgacaagatcaaaggcagtgcggtaaaccctgtactg
cgtgaaggtaactctgatcgccgcgcgccgctgtcagtgaaaaacttcgctaagaaaaac
ccacactcaatgggtaagtggaccaaagagtctcaatcacacgttgctcacatgagcgaa
ggtgacttctacggtagcgagcagtctgtgacgctggctaacgctgacacagttaacatc
gtactgtcgcaaaaagacggtcaagaagtggtattgaaatctggcctgaaactgctggct
ggtgagatcatcgacgcgtcagtgatgagcaaaaaagccctagttagcttctttgagcgt
gagatcgccaatgccaaggccgaaaacgtgttgttatcactgcaccttaaagccaccatg
atgaaagtgtccgatccgattatgttcggtcacgcagtcaaagtattcttcaaacctgtg
tttgataaacatgcgtcattatttgctgagctaggcgttgatgtgaacaacggctttggc
gatgtatatgccaaaatcgctagtttacctgccgatgttcgtgcacaaattgaagccgat
atcgccgccgtttatgctgagcgcccagcgctggcgatggtagattctgacaaaggcatc
accaacttacacgtaccaagcgacatcattatcgatgcttctatgccagcggccattcgt
tcatcaggccaaatgtggggtcctgatggcaaattgcacgatactaaagcgctgatccca
gaccgttgctacgcgggtgtgtatcaagaaaccatcgctttctgtaaagagcatggtgcc
ttcgatccaagcactatgggtagcgtgccaaacgtgggtctgatggcgcaaaaagccgaa
gaatatggtagccacgataaaaccttcgaaatcccagcggatggcgtggttaacgtgatt
gatgccagtggcaaagtgttaatgagccacaacgtcgaagcgggcgatatttggagaatg
tgccaagttaaagacgctccaattcgcgactgggtgaaattagctgtacgccgtgcacgt
ttaagcaatactcctgcggtattctggttagatgcgaatcgcgcccacgatgcgcagctg
atcgctaaagtgaagcaatatctacctgagcatgatactgacggtttagacatcagcatc
atgtcaccagaagaagcgactcgtttctcattagtgcgcattaaagaaggtaaagatact
atttctgttaccggtaacgtactgcgtgactacctgactgacttgttcccaatcctcgaa
ctgggtaccagtgctaagatgctgtctatcgtaccattaatgaatggtggcggcctgttc
gaaacgggtgcgggcggtagtgcgcctaaacacgtacaacaggttgaaaaagaaggtcac
ttacgttgggactcattaggtgagttcctggctttagcggcttctttagagcatttaagc
caaactgtgggtaatcctaaggcacaagtactggcagataccttagatcaagccatcggt
cagttcttagatagcaacaagtcgccatcaagacgcgttggtgagctggataaccgtggt
agtcatttctatctggcgatgtactgggcacaagcgttagccgctcaaaccaaagacgag
cagttacaagctcactttattccattagcgcacgcgttaagcgcaaatgagcaagtgatt
gttgctgagctaaacaatgcgcaaggtgcgccagtggatttaggcggttactatcgttta
gacgccgcaaaagctgaaaaagccatgcgcccaagcgagacactgaacaagctattaatt
gcttaa

DBGET integrated database retrieval system