KEGG   Shewanella sp. ANA-3: Shewana3_1853Help
Entry
Shewana3_1853     CDS       T00428                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
shn  Shewanella sp. ANA-3
Pathway
shn00340  Histidine metabolism
shn01100  Metabolic pathways
shn01110  Biosynthesis of secondary metabolites
shn01230  Biosynthesis of amino acids
Module
shn_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:shn00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Shewana3_1853
Enzymes [BR:shn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Shewana3_1853
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: ABK48084
UniProt: A0KWB5
Position
complement(2194820..2196121)
Genome map
AA seq 433 aa AA seqDB search
MDILTWAALSVDEQKAALQRSPLIGDSGLEQSVRAIVDAVASRGDAALKEFNQKFDGFNS
ANIDSLRLSESEISAASARVSAELKAAIAQAMANIDVFHSAQQFRPIDIETQAGVRCELR
SEPIEKVGLYIPGGSAPLISTVMMLALPAKIAGCEKRVLVSPPPINDAIVYAANACGITE
IYQVGGAQAIAALAFGTESIPSVDKIFGPGNRYVTEAKRLVSQDGRCTVSIDMPAGPSEV
LVIADSDANAQFIAADLLSQAEHGPDSQVILVTDSEPLAQAVNQALASQLAALPRQEIAT
TALKGSRTILVKDMQEAALVSNRYGPEHLIIQTRFPGDVLKHIRAAGSVFLGAYTPESVG
DYASGTNHVLPTYGYSRAVSSLSLADFSRRFTVQELSAKGLLGLGQAVMTLASNELLDAH
KNAVAIRLASLKD
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atggatattttgacttgggcagcgttatccgtcgatgaacaaaaagccgcgctccaacgc
tcgcctttaatcggtgacagcggcttagaacaaagtgttcgggcgattgtcgatgccgtg
gctagccgtggcgatgcggcgctgaaagagtttaatcaaaagtttgatggctttaatagc
gccaatatcgacagtctgcgcttaagtgaaagcgagattagcgccgccagcgcacgagtc
tcggcagaacttaaagccgccattgcccaagcgatggccaatattgatgtgttccacagc
gcgcagcaatttcgccccatagacattgaaacccaagcgggtgttcgctgcgagcttcgt
agcgaaccgattgaaaaagtcggtttatatattcccggcggcagcgcgcctctcatttcg
accgtgatgatgttggccctgcccgccaaaattgccggttgcgaaaaacgcgtattggtg
agtccgccgccgattaacgatgccattgtgtatgcggcaaacgcctgtgggatcaccgaa
atttaccaagtgggtggcgcgcaggccattgccgcattggcctttggcactgaatctatt
cctagcgtcgataagatttttggtccgggtaatcgttatgtcaccgaagccaaacgctta
gtctcccaagatgggcgctgcactgtgtctatcgatatgcctgcggggccttccgaggtg
ttggtgattgccgatagcgatgccaatgcgcagtttattgccgcggatttactctcccaa
gcggagcatggcccagattcgcaggtcattttagtcacggattctgagccattagcacag
gcagtcaatcaagcgctcgcgtcacaactggccgccctaccgcgccaagagattgccacg
accgccctaaaaggcagccgcaccattttggtaaaagatatgcaagaagcggcgctcgtt
tcaaatcgctatgggcccgaacacttaattattcaaacccgcttcccaggggacgtgcta
aaacatattcgggccgcaggctcagtgtttttaggcgcttatacacctgaatcggttggg
gattatgccagtgggactaaccatgtattgccaacttacggttatagccgcgcggtatct
agcctctccttggcagactttagccgccgctttacggtgcaagagctcagcgccaagggc
ctgctcggactcggacaagcggtgatgaccctggccagtaatgagttactcgatgcccat
aaaaatgcggtcgcgatacgcttagccagtcttaaggactga

DBGET integrated database retrieval system