KEGG   Shewanella sp. ANA-3: Shewana3_2026Help
Entry
Shewana3_2026     CDS       T00428                                 

Definition
(GenBank) type III restriction enzyme, res subunit
  KO
K01153  type I restriction enzyme, R subunit [EC:3.1.21.3]
Organism
shn  Shewanella sp. ANA-3
Brite
KEGG Orthology (KO) [BR:shn00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:shn02048]
    Shewana3_2026
Enzymes [BR:shn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.3  type I site-specific deoxyribonuclease
     Shewana3_2026
Prokaryotic defense system [BR:shn02048]
 Restriction and modification system (R-M system)
  Type I R-M system
   Shewana3_2026
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ResIII SWI2_SNF2 EcoEI_R_C HSDR_N Helicase_C HSDR_N_2 DUF4145 DEAD
Motif
Other DBs
NCBI-ProteinID: ABK48257
UniProt: A0KWT8
Position
2420829..2424245
Genome map
AA seq 1138 aa AA seqDB search
MKQSMNFEFLRKNWPELADFGAYAEEYAFSDPQSALIKLRSYSEYIVNFIYQKLNLPCLP
KASFHEKLVGEDFVQLASSAVLDKFHLIKTLGNKAAHENKGASNDALFAVKQSHQLGTWF
YCSYHNLQACTVPAFIELSEEFLTTSKLKKKLEQSDALYQQAMAELERQRLVNEQMFAAA
KQATAVKDTPVFEAFATNSQLLSSSLNFNEAETRKYLIDMELRDIGWEVSKDNKSTDQVG
QEVEVKHQPTNTGIGYVDYVLWDDDGLPLAVVEAKKTSKDARIGKKQAKDYADALEKHYG
QRPVIFYTNGHDIYIWDDAQGYPPRKIYGFYSKSSLQHLVKFQRIEKKKLTDVAIDTEVA
GRRYQLETISRVHETFELKRRKALVVQATGTGKTRVSIALAKSLMDAKWVKRILFLCDRK
ELRKQADKAFVQFLGVKPYVVGKSDKKYKDTARVFIATYPGMMGIYEDFDVGYFDLIIAD
ESHRSIYNVFGNLFKYFDCLQVGLTATPVEMVSRSTCNLFDCDYKEPTANYPLEKAIGEG
HLVPFEIVTMTTKFMREGMNQRSLSDEQIAELEAQGEDPNEFEFESAEIDNAVLNKDTNR
KILRNLMENGIKDKDNQLIGKSIIFARKINHARLLKELFDEMYPELSQGFCEVIHSEEPR
AEALIDQFKITEEEKAKDSSLPDPITLAISVDMLDTGIDVPSVVNLVFAKPVKSKVKFWQ
MIGRGTRLCEDLFGKGKHKTRFLIFDHWNNFDYFEFNYEEVEPSNTKSLAQKRFELRLQL
ASAALKKLELNAFSQTIKLLQQDINALNTRNINVRDHWAIVTQLSDVKVLEQFAKPTVAL
LESQIAPLMNWLVIKGQSKAFRWDCLIAQTQCELLLNREAIGELKLEVQSVLERLPKNTA
QVQAKATEIKFLMDSNSWLNITFYQLEQHRLALREIMYLLEGDILPPNPGPKYIDVKEDN
SHIEYKARAANIHTVDYQIYQQKVQEALQPIFDSNPVIQKIRKGQAVTVSEIAQLNGIIH
AKYANLDIETLKTFYPDTTEPLDKLLRSIVGMDTQYIEQSFTALLQKHRMPPQAMRVIDM
LIGHIARSGGIKMADLDQAPYNKIYEGILGSSEDDVFSLLRSLELPIPLTKAEMTAKN
NT seq 3417 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaatctatgaattttgagtttttacgaaaaaattggcctgagttagctgatttt
ggtgcttatgcagaagaatatgcatttagtgaccctcaaagtgcattgatcaaattacgt
tcttacagtgaatatatcgttaacttcatctatcaaaagctcaacttgccttgcctcccc
aaagcttcctttcatgaaaagctggtaggtgaggactttgtacaactcgcatcctctgca
gtattagataagtttcatctaattaaaaccttaggtaataaagctgcgcatgaaaacaaa
ggtgcaagtaacgatgctttgtttgccgttaagcaatcccatcaattaggtacttggttt
tattgtagttaccataatctgcaagcctgtactgttcctgcatttatcgagcttagtgaa
gaattcttaactacaagcaaactaaagaaaaaacttgagcaaagcgacgccctatatcag
caggcaatggcagagttagagcgacaacggctggttaatgaacagatgtttgctgccgcg
aaacaagctacggcagtgaaagatacaccagtatttgaagcattcgccaccaacagccaa
ttgttatctagcagcttgaattttaatgaagcagaaacgcgtaagtatcttattgatatg
gagctgcgtgacattggttgggaggtaagtaaagacaataagtcaaccgaccaagttggc
caggaagttgaagttaaacatcagccaaccaataccggcattggttatgtcgattacgtg
ctgtgggatgatgatggcttacctttggctgtggtggaagcaaagaaaacctctaaagat
gcacgcatcgggaaaaaacaagctaaggactatgccgatgccttagaaaaacattatggc
cagcgtccggtaatattctataccaatggtcatgacatctatatttgggatgatgctcag
ggttacccgcctcgtaaaatctatggtttttattccaaaagctctcttcagcacttggta
aagtttcagcgcattgaaaagaaaaaacttactgatgtggcgattgataccgaggttgct
ggccgtcgctatcagttggaaaccatatcccgtgtgcacgaaacctttgaactaaaacgt
cgcaaagccttagtagtgcaagcgacaggcactggcaaaacgcgtgtgtctattgccttg
gcaaaatcgttaatggatgcgaaatgggttaaacgcattttgtttttgtgtgaccgcaaa
gaattacgtaaacaagctgataaagcctttgttcagttcttgggcgtaaaaccctatgtc
gttggaaaaagtgataaaaaatataaagatacagcacgagtgtttattgctacttatccg
ggcatgatgggcatttacgaagatttcgatgttggttatttcgacctcatcattgccgat
gaatcgcaccgctcaatttacaatgtgtttggtaacttgtttaagtatttcgactgtttg
caagtgggcttaaccgcaacacccgttgagatggtctctcgctccacctgtaatttattt
gattgtgattacaaagaaccaaccgctaactatccgttagaaaaagccattggagaaggg
catttagtgccctttgaaattgtgaccatgaccactaaattcatgcgtgagggcatgaac
cagcgctctttaagcgatgagcaaatcgctgagttagaagcgcagggagaagatccaaac
gagtttgaatttgagtccgcagagatagataacgcggtcttgaacaaagataccaatcgc
aaaattctgcgtaatctcatggaaaatggcattaaagataaagacaaccagttgattggt
aagtcgataatctttgccagaaaaatcaaccacgctcgattattaaaagagctgttcgac
gagatgtacccggagctcagtcagggcttttgcgaagtcattcactctgaggaaccgcgt
gctgaagcactgattgatcaattcaaaattaccgaagaggaaaaagccaaagactcatca
ctgcctgaccccataaccttagctatctctgttgatatgctagatacagggattgatgtg
ccgagtgtggtcaatttggtgtttgctaaaccggttaaatcaaaggttaagttttggcaa
atgattggccgaggcacgcgtttatgcgaagacttgttcggcaagggtaagcataaaacc
cgcttcttgatatttgaccactggaataactttgattactttgaattcaactacgaagaa
gtcgaaccatccaacactaaatcactcgcgcaaaaaaggttcgagttacggttgcaactc
gcatccgcggcattaaaaaaactggaactaaatgcgttcagccaaacgatcaagctgttg
caacaagacatcaacgcactgaatacccgcaatatcaatgtgcgggaccattgggcaatt
gtgacacaattatctgatgtaaaagtgcttgagcagtttgccaaacccacagtagcttta
cttgaatcgcaaattgcccctctgatgaattggctggtgatcaaagggcaaagtaaagcc
tttcgctgggattgcctcatcgcccaaactcaatgtgagttattgctaaaccgagaagcc
ataggtgaattaaagcttgaggtacagagtgtgctagaacgcctgcccaaaaacaccgcg
caggtgcaggctaaggctaccgaaattaagtttttgatggatagcaacagttggctaaat
atcactttttaccagttggaacagcatcggttggcattgcgcgaaatcatgtatttgcta
gaaggcgacattctgcctcctaacccgggccccaaatatatcgatgttaaagaagacaat
tcacatatcgaatacaaagccagagcggcgaatattcatactgtcgattatcaaatctat
cagcaaaaagtacaggaggcactgcagcctatttttgatagcaatcccgttattcaaaaa
attcgtaaaggccaagccgtaactgttagtgaaatcgcccaactaaacggtatcatccac
gccaaatatgcaaatttggacattgaaaccctaaaaaccttttatccagacaccacagaa
cctctcgacaagcttttgcgcagtattgtggggatggatacacagtacatagagcaaagc
tttactgcactgttgcaaaaacatcgcatgccacctcaagccatgcgggtgattgatatg
ctgattgggcacattgcccgtagtggtggcataaaaatggccgatttagaccaagcgcca
tacaacaaaatatatgaaggtatcttgggcagctcagaagacgacgtcttttcgttgtta
aggtcattagagctgccaataccattaaccaaagccgaaatgacggcaaaaaattaa

DBGET integrated database retrieval system