KEGG   Shewanella sp. ANA-3: Shewana3_2771Help
Entry
Shewana3_2771     CDS       T00428                                 

Definition
(GenBank) acetyl-CoA acetyltransferases
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
shn  Shewanella sp. ANA-3
Pathway
shn00071  Fatty acid degradation
shn00072  Synthesis and degradation of ketone bodies
shn00280  Valine, leucine and isoleucine degradation
shn00310  Lysine degradation
shn00362  Benzoate degradation
shn00380  Tryptophan metabolism
shn00620  Pyruvate metabolism
shn00630  Glyoxylate and dicarboxylate metabolism
shn00640  Propanoate metabolism
shn00650  Butanoate metabolism
shn00900  Terpenoid backbone biosynthesis
shn01100  Metabolic pathways
shn01110  Biosynthesis of secondary metabolites
shn01120  Microbial metabolism in diverse environments
shn01130  Biosynthesis of antibiotics
shn01200  Carbon metabolism
shn01212  Fatty acid metabolism
shn02020  Two-component system
Brite
KEGG Orthology (KO) [BR:shn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Shewana3_2771
   00630 Glyoxylate and dicarboxylate metabolism
    Shewana3_2771
   00640 Propanoate metabolism
    Shewana3_2771
   00650 Butanoate metabolism
    Shewana3_2771
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Shewana3_2771
   00072 Synthesis and degradation of ketone bodies
    Shewana3_2771
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Shewana3_2771
   00310 Lysine degradation
    Shewana3_2771
   00380 Tryptophan metabolism
    Shewana3_2771
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Shewana3_2771
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Shewana3_2771
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Shewana3_2771
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:shn04147]
    Shewana3_2771
Enzymes [BR:shn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Shewana3_2771
Exosome [BR:shn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Shewana3_2771
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt PDT
Motif
Other DBs
NCBI-ProteinID: ABK48998
UniProt: A0KYX9
Position
complement(3310297..3311487)
Genome map
AA seq 396 aa AA seqDB search
MSTEQFNQEIVIVAAKRTPMGGFQGSLSGVMSPSLAATAIKALLADTQVAPDKVDEVLMG
CVLPAGLGQAPARQATLGAGLPLSVGATTVNKVCGSGMKTVMLAHDLLKAGSAKLVVAGG
MESMSQAPYLLDKARAGMRMGHGKVLDHMFLDGLEDAYTGGAMGTFAQKTADEYGLTREQ
MDAFALSSLEKANAAINSGAFKAEIVPVTVSDRRGDVTVDTDEQPGNARPEKIPALRPAF
AKDGTITAANSSSISDGAAALMLTTRANAEQLGLTVLATIKGHTTHAQEPSLFTTAPVGA
MAKLLSNVGWSKDEVDLFEINEAFAMVTMLAVSELGLDMAKVNVNGGACALGHPIGCSGA
RLLVTLIHALKARGLKRGVASLCIGGGEATAMAIEV
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgagtactgaacaatttaaccaagagatcgttattgttgccgctaaacgcaccccaatg
ggtggctttcaaggcagtttgtctggcgtaatgtctccgagcttagcggccaccgccatc
aaagccctgttagccgatacccaagttgcgcctgacaaggtcgatgaagtgttaatgggc
tgcgtattacctgcgggtctgggccaagcgcctgcgcgtcaggcgaccttaggtgcaggt
ttacccctgtctgtaggtgctacgaccgtaaacaaagtctgtggctctgggatgaaaacc
gtgatgcttgcccacgatttacttaaagcgggcagtgctaagttggtggttgcgggcggt
atggaaagtatgagccaagccccttacttgctggataaagcgcgcgctggcatgcgtatg
ggccatggcaaggtattagatcatatgttcctcgacggtttagaagatgcctacactggc
ggcgccatgggcacattcgcccagaaaactgccgacgaatatggtttaacccgcgagcaa
atggatgcgtttgctttaagctcgctcgaaaaagccaatgccgcgattaactctggtgcc
ttcaaggcggaaattgtacctgtgactgtgagcgatcgccgtggtgatgtgactgtcgat
accgatgagcagccaggtaacgcccgccctgaaaaaatccccgcactgcgcccagctttt
gccaaagacggcactattacggcggcaaactcaagctctatttccgatggtgcggcggcg
ctgatgctaaccacgcgcgccaatgccgagcagttaggcttaacagtgctggccaccatc
aaggggcacacaacccatgcacaggagccatcactctttaccacggcacccgttggcgct
atggcaaaactgctgagcaatgtcggctggtctaaggatgaggttgacctgttcgaaatc
aacgaagcctttgccatggtgactatgctggccgtttctgaattaggtttagatatggca
aaagtgaacgtgaacggtggcgcctgcgccttaggtcatcctatcggttgctcgggtgca
cgtttgctggtgaccttaatccatgcacttaaagcccgtgggcttaagcgtggcgtagcc
tcactctgtatcggtggtggtgaagctaccgctatggctatcgaagtctaa

DBGET integrated database retrieval system