KEGG   Shewanella sp. ANA-3: Shewana3_2809Help
Entry
Shewana3_2809     CDS       T00428                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
shn  Shewanella sp. ANA-3
Pathway
shn00900  Terpenoid backbone biosynthesis
shn01100  Metabolic pathways
shn01110  Biosynthesis of secondary metabolites
shn01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:shn00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Shewana3_2809
Enzymes [BR:shn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Shewana3_2809
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXPR_C DXP_reductoisom DXP_redisom_C NAD_binding_3 Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: ABK49036
UniProt: A0KZ17
Position
complement(3356445..3357635)
Genome map
AA seq 396 aa AA seqDB search
MQNMVILGATGSIGASTLSVISANPDAYRVYALVANASVDKMLALCVTHRPQVAHMVDSQ
AALALQAKLPPELNIQVTSGEDELIALVTATEVDTVMAAIVGAAGLVPTLAAVKAGKRVL
LANKEALVMSGELFIEATKASGATLLPVDSEHNAIFQCLPEEVQANLGRCDLAASGISHI
LLTGSGGPFLTAELASLASMTPAQACKHPNWSMGPKISVDSATMMNKGLEFIEARWLFNT
QKDQLKVVIHPQSVIHSMVQYRDGSVIAQMGNPDMRTPIAHCMSYPQRIRSGVEPLDFFK
VGQLSFCEPDFNRFPCLALAIAACAQGQEATTVLNAANEIAVEAFLQGQIGFTHIAKVNE
ACLSSVPKRAMTSIDDIIALDAQTRIYAREQLAKFA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaatatggtgattttgggcgcaaccgggtcgattggtgccagcactttaagtgta
atttcggctaatcccgatgcttatcgtgtttacgctttagtggcgaatgcgagtgtcgat
aagatgctcgccctgtgtgtgacccatcgcccccaagtcgcccatatggtcgatagtcag
gccgcattagcgctacaagctaagcttccccctgagcttaatatccaagtcacaagtggc
gaggatgaactcatcgccttagtcacagccaccgaagtggatactgtgatggccgctatc
gtcggcgcagcggggttagtgcccaccttagccgctgtcaaagcgggtaagcgagtatta
cttgccaataaagaggccttggtgatgtcaggtgaactctttattgaggccacgaaagca
tcgggcgctactttgttgccggtcgatagtgagcacaatgcaattttccaatgcttaccc
gaagaggtgcaggctaatttaggccgctgtgatttagccgcatcgggcatttcacatatt
ttactgacaggctctggcggcccctttttaaccgctgagcttgccagccttgcgtctatg
acgccagcgcaggcctgtaaacatccaaactggtcgatgggcccgaaaatttcagtcgac
tccgccactatgatgaataaaggcttggagtttattgaagctcgttggttgtttaatact
cagaaagaccaattaaaggtggttatccatccgcagagtgttatccattcgatggtgcaa
taccgggatggtagcgtgatcgcgcaaatgggtaacccggatatgcgtacaccgattgca
cattgtatgtcctatccacaaagaattcgctctggcgttgaacctttggattttttcaaa
gtcggacagttaagcttttgtgagccagactttaatcgcttcccctgtttggcgttagcg
atcgccgcttgtgcccaaggtcaagaagcgactacggtactcaatgccgccaatgaaatc
gccgttgaggcatttttacaggggcagattggttttacccatatcgccaaggtgaatgaa
gcctgtttatcctctgtgcctaaacgggcgatgaccagcatcgatgatattatcgccctg
gatgcacaaacgcggatttatgcccgcgaacagttagcgaaatttgcttaa

DBGET integrated database retrieval system