KEGG   Shewanella sp. ANA-3: Shewana3_2824Help
Entry
Shewana3_2824     CDS       T00428                                 

Definition
(GenBank) tRNA pseudouridine synthase C
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
shn  Shewanella sp. ANA-3
Brite
KEGG Orthology (KO) [BR:shn00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:shn03016]
    Shewana3_2824
Enzymes [BR:shn01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     Shewana3_2824
Transfer RNA biogenesis [BR:shn03016]
 Prokaryotic type
  tRNA modification factors
   Psudouridine synthases
    Shewana3_2824
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: ABK49051
UniProt: A0KZ32
Position
complement(3373305..3374159)
Genome map
AA seq 284 aa AA seqDB search
MNLDDDWLDMPEDKFNPTESDEQSEPAPELRVLYQDEHLVAIHKPAGLLVHRSYLARRER
FFAMQLTRDLVGCHVFPVHRLDRPTSGVLLFAKSSEVANALCEQFANHSIEKQYLALVRG
NMHESGVLDYALKVELDEVADKFANQDKAAQDAVTQYEPLLNTEIPYPSGRYATSRFALV
KLSPKTGRKHQLRRHMAHLRHPIIGDTTHGDGKQNAFFRTHFDINRLWLIAKKLTFTHPV
TQARLSIETELEPEWETVFSGLGWDDAALCCEPSVLIAEQTTTV
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgaacctagatgatgattggctggatatgccagaggataaattcaacccaaccgagagc
gacgaacagtcagagcctgcgcctgaactgcgtgttttgtatcaagacgagcacttggtg
gctatccataaacccgcgggattattggttcatcgcagctacttagcacggcgtgaacgc
ttttttgcgatgcaactgactcgtgacttggtcggttgccatgtgtttccggtacaccgt
ttagatagaccgacctcgggcgtgttgttatttgccaaaagcagtgaggtggccaatgcc
ctatgtgagcaatttgccaaccacagtattgaaaaacaatatttggcactggtgcgtggc
aatatgcacgagagtggtgtgttggattatgcgctcaaagtcgaattggatgaggtggct
gacaagtttgccaatcaagataaggccgcgcaggacgctgtgactcaatatgagccgcta
ttaaataccgaaattccttatccgtcggggcgttacgctaccagccgtttcgcgttagtg
aaactgagtccaaaaacggggcgtaagcatcaactcagacgccatatggcgcatttacgt
cacccgattattggcgataccacgcacggagatggtaagcaaaatgcgtttttccgtacg
catttcgatatcaatcgattgtggctgattgcgaagaagttaaccttcactcacccagtt
acccaagcgcgactgagtatcgaaaccgagcttgagccagaatgggaaaccgtgttttca
ggactgggctgggatgatgccgccctttgttgcgagccaagtgtgttgattgcagagcaa
acgacgaccgtttaa

DBGET integrated database retrieval system