KEGG   Shewanella sp. ANA-3: Shewana3_3330Help
Entry
Shewana3_3330     CDS       T00428                                 

Definition
(GenBank) thiol:disulfide interchange protein DsbC
  KO
K03981  thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
shn  Shewanella sp. ANA-3
Brite
Enzymes [BR:shn01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Shewana3_3330
Chaperones and folding catalysts [BR:shn03110]
 Protein folding catalysts
  Protein disulfide isomerase
   Shewana3_3330
Secretion system [BR:shn02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Shewana3_3330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thioredoxin_2 DsbC_N DSBA Thioredoxin_4 Thioredoxin_3 DUF1945
Motif
Other DBs
NCBI-ProteinID: ABK49554
UniProt: A0L0I5
Position
complement(3991700..3992425)
Genome map
AA seq 241 aa AA seqDB search
MKLTRALSLVIALVVAPLASAATATTPDTAAIKQKLSEMLDVEVISMQDSPIEGLYQAMT
NRGVLYISRDGTKLFHGNLYDLDKGMKNLTEAALAGPRLEMMKPLEDHMLVYKAKDEKHV
VTVFTDVSCGYCRKLHSQMADYNKMGITVRYLAFPRAGVPSANADEMQAIWCAKDPLKAM
TEAKAGQKVSAATCDAKIAEQYELGTSFGVNGTPAIVLEDGSMIPGYQPPADLLRTLEAR
K
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgaagttgacccgagcattatctttagttatcgcgcttgttgttgcgcctctggccagc
gccgctacggcgaccactcccgacaccgctgctattaagcaaaaactcagcgagatgtta
gacgttgaagtgatttcaatgcaggactcgccgattgaaggtttataccaagccatgacc
aatcgtggtgtgctctatattagccgtgatggcacaaaactgttccacggtaacttgtac
gatctcgataaggggatgaaaaacctgacggaagccgcacttgctggcccgcgtctagag
atgatgaagccacttgaagatcatatgttggtatacaaggctaaggatgaaaaacacgta
gtgacggtatttaccgatgtaagctgtggctattgccgcaagttgcatagccaaatggcc
gactacaacaagatgggcattaccgtgcgttacttagctttcccacgtgctggcgtacca
tctgccaatgccgatgaaatgcaagccatctggtgtgctaaggatccattaaaggccatg
acagaagccaaggcgggccaaaaagtgtctgccgcgacctgtgatgccaaaattgccgag
cagtatgagttaggcaccagctttggtgttaacggcacgcctgcaatcgtattggaagat
ggcagcatgatccctggatatcaaccacctgcggatttactgcgtaccttagaagcgcgt
aaataa

DBGET integrated database retrieval system