KEGG   Shewanella sp. ANA-3: Shewana3_3477Help
Entry
Shewana3_3477     CDS       T00428                                 

Definition
(GenBank) ribokinase
  KO
K00852  ribokinase [EC:2.7.1.15]
Organism
shn  Shewanella sp. ANA-3
Pathway
shn00030  Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:shn00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Shewana3_3477
Enzymes [BR:shn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Shewana3_3477
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin Carb_kinase
Motif
Other DBs
NCBI-ProteinID: ABK49700
UniProt: A0L0Y1
Position
4171135..4172046
Genome map
AA seq 303 aa AA seqDB search
MSHILVIGSANADHVMNFEYLPVPGQTLMSRAYRLEHGGKGANQAVACARLCQGDAEVAF
ICHLGQDSVGNDMRTSWLKDGIKAEGITQVANMSTGTALIFVGDNGENSIGIAAGANADL
TPSELEKHYALFANAQFLLIQLETPMETVHHALQTAKRLGITTVLNPAPATSQELDYLKW
VDIITPNETEAEALTGIEVNNEEDAELAAQWLHQQGVATVVITLGSKGAFISSAGFTGLI
PALTVQAIDTVAAGDTFNGALVVGLSEGMSIAAAVGFANAASAITVTREGAQRAIPYRHE
VQR
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgagccacatactcgttataggcagtgccaacgccgatcatgttatgaattttgagtat
ttgcccgttcccggccaaaccttaatgagccgagcctatcgcttggaacacggtggcaaa
ggagccaatcaggcggtagcctgtgcccgtttatgccaaggggatgcggaagtggcattt
atctgccatctcggccaagacagtgtcggcaatgacatgcgtacaagctggctcaaggat
ggcattaaggccgaaggtattacccaagtcgccaatatgagtacgggcacggcgctgatt
tttgtcggcgataatggggagaactccatcgggatcgccgcgggcgccaatgccgatctc
accccaagcgagttagagaagcattacgccctgtttgccaatgcccaattcttactgatc
cagctcgaaacgccgatggagacggttcaccacgcattgcaaaccgccaagcgcctcggt
attaccacagtgctgaatcctgcgcctgcaaccagtcaggagttggattacctcaaatgg
gtcgacatcattactcccaatgagaccgaggccgaagcacttacaggcattgaggtcaat
aacgaagaagatgccgagcttgccgcccaatggctacatcagcagggcgttgcaactgtc
gtcataaccttaggcagtaaaggcgcgtttatcagcagtgccggttttaccgggttaatt
ccggcgctgacagtgcaagccatagatacggttgccgcgggcgatacctttaatggcgcc
ttagtggtgggtttaagtgaagggatgtcaattgcagcggccgtcgggtttgccaatgcc
gcctctgccattaccgttacccgagaaggcgcccagcgcgcgattccctatcgccacgaa
gtccaacgttaa

DBGET integrated database retrieval system