KEGG   Shewanella sp. ANA-3: Shewana3_3507Help
Entry
Shewana3_3507     CDS       T00428                                 

Definition
(GenBank) short-chain dehydrogenase/reductase SDR
  KO
K13938  dihydromonapterin reductase / dihydrofolate reductase [EC:1.5.1.50 1.5.1.3]
Organism
shn  Shewanella sp. ANA-3
Pathway
shn00670  One carbon pool by folate
shn00790  Folate biosynthesis
shn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:shn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Shewana3_3507
   00670 One carbon pool by folate
    Shewana3_3507
Enzymes [BR:shn01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Shewana3_3507
    1.5.1.50  dihydromonapterin reductase
     Shewana3_3507
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase NmrA GDP_Man_Dehyd NAD_binding_10 RmlD_sub_bind
Motif
Other DBs
NCBI-ProteinID: ABK49730
UniProt: A0L111
Position
complement(4207997..4208716)
Genome map
AA seq 239 aa AA seqDB search
MTAPIIITGVGKRIGYALAKHLLAQGHKVIGTYRSHYPSIDELQSLGATLIQCDFYDNAQ
LQTLIEQLSQYPKIRAIIHNASDWLPDNSPSLAAHEVMQRMMQVHVSVPYQMNLALASQL
RAGGEGEIGASDIIHFTDYVAEKGSAKHMAYAASKAALDNLTLSFAAQLAPEVKVNAIAP
AMILFNPSDDEAYRQKTLAKAILPKEAGNQEIIALVDYLLASRYVTGRCHNVDGGRHLK
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgacagctcccataattatcactggcgtgggtaaacgcattggctacgccctcgcgaaa
cacttgcttgcccaagggcacaaggtgattggcacctatcgcagccattatcccagtatt
gatgagttacagtctttgggcgcgaccttaatccaatgcgatttttacgataatgcgcag
ctacaaaccctgattgagcaattgagccaatatcccaaaatacgcgctattatccataac
gcctctgactggctgccagacaacagcccaagccttgccgcccatgaagtcatgcagcgg
atgatgcaggtgcatgtgagcgtaccctatcaaatgaacttggccttagcctcacagctg
cgtgctgggggcgagggcgagattggcgccagcgatattatccatttcaccgattatgtg
gccgaaaagggcagtgccaagcacatggcctacgcggccagcaaggcggcgctggataac
ttaaccttatcctttgcggcacaattagcgcccgaggtcaaagtcaatgcgattgctccg
gcgatgatcctctttaatccaagcgatgatgaagcctatcggcaaaagaccttggctaag
gcaatcttgccaaaagaagcaggaaatcaggagattatcgccttagtggattatctcttg
gcgagccgctacgtcactggtcgctgccacaatgtcgatggcggtcggcatttaaagtaa

DBGET integrated database retrieval system