KEGG   Shewanella sp. ANA-3: Shewana3_4261Help
Entry
Shewana3_4261     CDS       T00428                                 

Definition
(GenBank) hypothetical protein
Organism
shn  Shewanella sp. ANA-3
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TraL
Motif
Other DBs
NCBI-ProteinID: ABK50477
UniProt: A0L345
Position
p1:complement(137972..138256)
Genome map
AA seq 94 aa AA seqDB search
MSEARFPKRCNGAIKVGTIHWDSIKLAVIVMVFGLASGHINLGIIAAITSMAVVETLFKK
FGRGVLKHLLWVNGLWISKGPETLMSPAIRRLIK
NT seq 285 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaagcgagatttcctaagcgttgtaacggcgctatcaaagttggaactatccac
tgggactcaatcaagctggcggtgattgtgatggtttttggtcttgcatcaggtcacatc
aacttaggcattatcgcggcaattaccagcatggccgtagtagaaacactgtttaaaaag
tttgggcgtggcgtattaaagcatctgttatgggtaaacggtttgtggatttccaaaggg
ccggaaaccctcatgtcaccagccattcgtcgattaattaagtaa

DBGET integrated database retrieval system