KEGG   Shewanella sp. ANA-3: Shewana3_4270
Entry
Shewana3_4270     CDS       T00428                                 
Name
(GenBank) hypothetical protein
  KO
K12057  conjugal transfer pilus assembly protein TraF
Organism
shn  Shewanella sp. ANA-3
Brite
KEGG Orthology (KO) [BR:shn00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:shn02044]
    Shewana3_4270
Secretion system [BR:shn02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Shewana3_4270
SSDB
Motif
Pfam: TraF Thioredoxin_8 Redoxin AhpC-TSA Thioredoxin Thioredoxin_2
Other DBs
NCBI-ProteinID: ABK50486
UniProt: A0L354
Position
p1:147519..148514
AA seq 331 aa
MKVNKLMALIFAALALPVVAEDPANSNDGGNFYKQREKGWYWHEYIPEPEEKEEEEPIVP
TPSSAPTETETSKNSVEAMSVKWFQENLPKAKELALNTGKPEDVKRYLYIQRAAIDRANQ
FAATYISEQMFDPYLDEGLRRPENDVTLQTFKGAQSENQWKLIEAIGKKATLIYFYGSQC
PYCAKQTPYLIRLAKEYGWSIMPVSLDGGTVPNDDFLALGDYRVATSDMAQRFDVLATPT
LYLTNNTGDYFLLGSGLIGMDSLSERIIELASREKIISQAELNNVKQVRALYMTDAEAKV
DTQKVYEDPDYLINKMRNFMLGKPDSEGEQE
NT seq 996 nt   +upstreamnt  +downstreamnt
atgaaagtaaataaattgatggctttgatttttgcggctctggctctgccagttgtggca
gaagatcctgcaaatagcaatgatggtggtaacttctataaacaacgcgaaaagggctgg
tattggcacgagtacattcctgagcccgaagaaaaggaagaggaagaacctatagtgcca
acgccatcttctgcaccaactgagactgaaacgagtaaaaattcagtagaggccatgagc
gttaagtggttccaagaaaacttgcccaaggcaaaggagttggcgcttaacactggaaaa
ccagaagacgttaaacgctacctttacatccagcgtgccgcaatagatcgcgccaaccag
tttgccgctacttatatttccgaacaaatgtttgacccttacctcgatgaagggttacgc
cgtcctgaaaacgacgtgacgctgcaaactttcaaaggcgctcagtctgaaaaccaatgg
aagttaattgaagccatcggcaagaaagccaccctcatttatttctacggctctcagtgt
ccgtattgcgcaaagcaaactccctacctaatccgtctggcaaaggaatatggatggtcg
atcatgcccgtttctctcgatggcggcaccgttccaaatgatgactttttagcattaggc
gattatcgagtggcgacttccgacatggcgcagcgcttcgacgtcttggcgacaccaaca
ctgtatctaaccaacaacacgggtgattacttcctgttgggttctgggctaatcggcatg
gattctctcagtgaaaggatcatcgaactcgctagccgcgagaaaattattagccaagca
gaacttaataatgtgaagcaggtacgagctctgtatatgaccgatgcagaagccaaggtt
gacacgcaaaaagtgtatgaagacccagactacctcattaacaagatgcggaattttatg
ctcggaaaacctgatagcgagggtgaacaagaatga

DBGET integrated database retrieval system