KEGG   Streptomyces hygroscopicus subsp. jinggangensis TL01: SHJGH_3847Help
Entry
SHJGH_3847        CDS       T02531                                 

Definition
(GenBank) gamma-glutamyl kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
sho  Streptomyces hygroscopicus subsp. jinggangensis TL01
Pathway
sho00330  Arginine and proline metabolism
sho00332  Carbapenem biosynthesis
sho01100  Metabolic pathways
sho01130  Biosynthesis of antibiotics
sho01230  Biosynthesis of amino acids
Module
sho_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:sho00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    SHJGH_3847
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    SHJGH_3847
Enzymes [BR:sho01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     SHJGH_3847
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: AGF63512
Position
complement(4387903..4389009)
Genome map
AA seq 368 aa AA seqDB search
MGEARRIVVKVGSSSLTTAAGGLDADRVDALVDVLAKIRSGGEKEIVLVSSGAIAAGLAP
LGLRRRPKDLARQQAAASVGQGLLVARYTASFARYGVRVGQVLLTSDDMSRRAHHRNASR
TLDQLLAMGAFPIVNENDTVATDEIRFGDNDRLAALVAHLVHADLLVLLSDVDGVYDGDP
SRPGTSRIAEVKGPQDLAGVEIGSAGKAGVGTGGMVTKVEAARIAAAAGIPVVLTSAVHA
AEALAGGDTGTYFHATGKRSAERLLWLQHASTPQGALILDDGAVDAVVQRRTSLLPAGIA
AVEGEFSAGDPVELRDTTGHAVARGLVNFDAKEIPRLIGRSTRELARELGPAYEREVVHR
DDLVLLHT
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
gtgggcgaggcccgcaggatcgtcgtcaaggtgggctcctcctcgctgaccaccgccgcg
ggcggcctcgacgccgaccgcgtcgacgcgctggtcgacgtcctcgccaagatccgcagc
ggtggcgagaaggagatcgtgctggtctcctccggcgccatcgccgccggcctcgccccg
ctcggtctgcggcgccgccccaaggacctcgcgcgccagcaggccgccgccagcgtcggc
cagggcctgctcgtcgcccgctacaccgcctccttcgcccgctacggcgtccgcgtcggc
caagtcctgctcaccagcgacgacatgagccgccgcgcccaccaccgcaacgcctcccgc
accctcgaccagctcctcgcgatgggcgccttcccgatcgtcaacgagaacgacaccgtc
gccaccgacgagatccgcttcggcgacaacgaccgcctcgccgccctcgtcgcccacctc
gtccacgccgacctgctggtcctcctctccgacgtcgacggcgtctacgacggcgacccc
agcaggcccggcacctcccggatcgcggaggtgaagggcccgcaggacctcgccggcgtc
gagatcggcagcgcgggcaaggccggcgtcggcaccggcgggatggtcaccaaggtggag
gccgcccggatcgccgccgccgccggcatcccggtggtgctgaccagcgccgtccacgcg
gccgaggccctggccggcggtgacaccggcacctacttccacgccaccggcaagcgctcc
gccgagcggctcctctggctccagcacgcctccaccccgcagggcgccctgatcctggac
gacggcgcggtggacgcggtcgtccagcggcgcacatcgctgctgcccgccgggatcgcc
gccgtcgagggcgagttcagcgcgggcgaccccgtcgagctgcgggacaccacgggccac
gcggtggcccggggactcgtcaacttcgacgccaaggagatcccccggctgatcgggcgt
tcgacccgcgagctggcacgcgagctcggcccggcgtacgaacgcgaggtcgtacacagg
gacgacctggtcctcctgcacacctga

DBGET integrated database retrieval system