KEGG   Streptomyces hygroscopicus subsp. jinggangensis TL01: SHJGH_5642Help
Entry
SHJGH_5642        CDS       T02531                                 

Definition
(GenBank) cholesterol oxidase
  KO
K03333  cholesterol oxidase [EC:1.1.3.6]
Organism
sho  Streptomyces hygroscopicus subsp. jinggangensis TL01
Pathway
sho00984  Steroid degradation
sho01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sho00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    SHJGH_5642
Enzymes [BR:sho01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     SHJGH_5642
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GMC_oxred_C GMC_oxred_N DAO FAD_binding_2 Pyr_redox_2 NAD_binding_8 FAD_binding_3 Fer4_9 Fer4_10 Pyr_redox Fer4 Fer4_6
Motif
Other DBs
NCBI-ProteinID: AGF65305
Position
6384855..6386633
Genome map
AA seq 592 aa AA seqDB search
MPQDAYDYDVLIVGSGFGGSVSALRLTEKGYKVGVLEAGRRFTRATLPKNSWDLKNYLWA
PRLGMFGIQRIHLLGNVMVLAGAGVGGGSLNYANTLYVPPKPFFEDPQWRHITDWQEELG
PYYDQARRMLGVRLNPTMTPSDVHLKAAAERMGVGDTFHLAPVGVFFGDGEDADGKAKAR
PGERVSDPYFGGAGPDRRACTECGECMTGCRHGAKNTLNENYLYLAEKAGAVVHPMTTVV
SVTDDSRGGYAVATLPTDRKKTGEGRLFTARKVVLAAGTYGTQTLLHRMKAGGQLPYLSA
RLGDLTRTNSEALVGAQTDNRRYRRATGAPRADFTRGVAITSSIHPDENTHIEPVRYGKG
SNSMGGLSILQVPYAEGSSRVLAWLANAARHPMLVARSLSNRRWSERTIIGLVMQSLDNS
LTTYLKPGGIGRGLLTARQGHGAPNPKQIRAATEAASALAAEINGFAGSNVGELMGTPLT
AHFLGGCPIGDSPETGVIDPYHRLYGHPGISVVDGAAVSANLGVNPSLTITAQAERAMSF
WPNKGEEDPRPAPGAAYERLKPVEPQTPAVPADAFGALRLPFLGMPAVPPKK
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
gtgccgcaagacgcctacgactacgacgtcctgatcgtcggctccggcttcggcggctcg
gtgtccgccctccggctcaccgagaaggggtacaaggtcggggtactggaagccggacgc
cgcttcacccgcgccacgctgccgaagaactcctgggacctgaagaactacctctgggcc
ccgaggctcggcatgttcggcatccagcgcatccacctgctgggcaatgtgatggtgctg
gccggcgcgggcgtcggcggcggctccctcaactacgccaacaccctctacgtgccgccg
aagcccttcttcgaggacccccagtggcggcacatcaccgactggcaggaggagctgggg
ccgtactacgaccaggcccggcgcatgctcggggtgcggctcaaccccaccatgaccccc
tccgacgtccacctgaaggcggcggccgagcggatgggcgtcggcgacaccttccacctg
gccccggtgggcgtgttcttcggtgacggcgaggacgccgacggcaaggcgaaggcccgg
cccggcgagcgggtgagcgacccgtacttcggcggggccggccccgaccggagggcctgc
accgagtgcggcgagtgcatgaccggctgccggcacggcgcgaagaacaccctcaacgag
aactacctgtacctcgccgagaaggccggcgccgtcgtgcaccccatgacgacggtcgtg
tccgtcacggacgactcgcgcggcggctacgcggtggcgaccctgccgacggaccggaag
aagacgggcgagggccggctcttcaccgcccgcaaggtggtcctcgcggccggcacctac
ggcacccagaccctgctgcaccgcatgaaggccggaggccagctgccctacctgtccgcc
cggctcggcgacctgacccgcaccaactccgaggccctggtcggcgcgcagaccgacaac
cgccgctaccgcagggccaccggcgcgccgcgggccgacttcacgcggggcgtcgccatc
acgtcctcgatccaccccgacgagaacacccacatcgaacccgtccggtacggcaagggc
tccaactcgatgggcggcctgtccatcctccaggtgccctacgccgagggctcctcgcgc
gtcctcgcctggctggcgaacgcggcccggcacccgatgctggtcgcccgctccctgtcc
aaccggcgctggtcggagcggaccatcatcggcctggtcatgcagtccctggacaactcg
ctgaccacgtacctcaagcccggcggcatcggcaggggcctgctcaccgcgcggcaggga
cacggcgcgccgaaccccaagcagatcagggccgcgaccgaggccgcctccgcgctcgcc
gccgagatcaacggcttcgccggcagcaacgtcggcgagctgatgggcaccccgctcacc
gcgcacttcctcggcggctgccccatcggcgactccccggagacgggcgtgatcgacccg
taccaccggctctacggccaccccggcatctcggtcgtggacggcgccgcggtctcggcg
aacctgggggtgaacccctcgctgacgatcaccgcacaggccgagcgggcgatgtccttc
tggccgaacaagggcgaggaggacccgcggccggcacccggagcggcgtacgagcggctg
aagccggtggagccgcagaccccggcggtcccggcggacgcgttcggcgcgctgcggctg
ccgttcctggggatgccggcggtaccgccgaagaagtga

DBGET integrated database retrieval system