KEGG   Streptomyces hygroscopicus subsp. jinggangensis TL01: SHJGH_5702Help
Entry
SHJGH_5702        CDS       T02531                                 

Definition
(GenBank) putative ornithine cyclodeaminase
  KO
K21721  N-[(2S)-2-amino-2-carboxyethyl]-L-glutamate dehydrogenase [EC:1.5.1.51]
Organism
sho  Streptomyces hygroscopicus subsp. jinggangensis TL01
Pathway
sho00998  Biosynthesis of secondary metabolites - other antibiotics
sho00999  Biosynthesis of secondary metabolites - unclassified
sho01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sho00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of secondary metabolites - other antibiotics
    SHJGH_5702
   00999 Biosynthesis of secondary metabolites - unclassified
    SHJGH_5702
Enzymes [BR:sho01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.51  N-[(2S)-2-amino-2-carboxyethyl]-L-glutamate dehydrogenase
     SHJGH_5702
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OCD_Mu_crystall F420_oxidored
Motif
Other DBs
NCBI-ProteinID: AGF65365
Position
6472573..6473616
Genome map
AA seq 347 aa AA seqDB search
MTSQVSQVPSFSVISGAQVHQVLAGAEDEVVSTVEAAYRLHGEARTVNPDSYFLRFPDRP
SSRIIALPASVGGDVDVHGIKWISSFPENVAAGLPRASAVLVLNDARTGYPFACLESSII
SAARTAASAALAADRISRARGTRPTRVGFIGTGLIARYLHTYLAASGFAFDALGVHDLSA
EHAEGFTGYLRRTAGDGAEITVHDKPEDLIRASDLVVFATVAGEPHVTDPEWFTHNPLVL
HVSLRDLSPQIILSAWNAVDDIDHCLKANTSPHLAEQLTGNRDFVAGTLHDVLTGAITPP
ADRPVVFSPFGLGVLDLAVAKYVYDRVRDAGQLHTVPGFFHELKRYG
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgacctcacaggtgtcccaggtcccgtccttctccgtgatctccggtgcccaggtgcac
caggtgctcgccggcgccgaggacgaggtcgtctcgaccgtcgaggccgcctaccggctg
cacggcgaggcacggacggtcaaccccgactcgtacttcctgcgcttcccggaccgcccg
tcctcccggatcatcgcgctgcccgcctcggtgggcggtgacgtggacgtgcacggcatc
aagtggatctccagcttcccggagaacgtggccgccggcctgccgcgcgcctcggccgtc
ctcgtcctcaacgacgcgcggacgggttacccgttcgcctgcctggagtcctccatcatc
agcgccgcccgcaccgccgcctcggcggccctcgcggccgaccggatcagccgggcgcgc
ggcacccggcccacccgggtcggcttcatcggcaccggcctgatcgcccgctacctgcac
acctacctggcggcctccggcttcgccttcgacgccctcggcgtgcacgacctgtccgcc
gagcacgccgagggcttcacgggctatctgcggcgcacggccggggacggcgcggagatc
accgtgcacgacaagccggaggacctgatccgcgccagcgacctcgtcgtcttcgcgacc
gtcgcgggcgagccgcacgtgaccgacccggagtggttcacgcacaacccgctggtgctg
cacgtgtcgctgcgcgacctgtccccgcagatcatcctctccgcctggaacgcggtcgac
gacatcgaccactgcctcaaggccaacacctcgccccacctggccgaacagctcaccggc
aaccgggacttcgtcgccggcaccctccacgacgtgctgaccggcgcgatcaccccgccc
gccgaccggccggtggtcttctcgccgttcggcctgggcgtgctcgacctggcggtcgcg
aagtacgtgtacgaccgggtccgggacgccggccaactgcacaccgtgcccgggttcttc
cacgagctgaagcggtacggctga

DBGET integrated database retrieval system