KEGG   Streptomyces hygroscopicus subsp. jinggangensis TL01: SHJGH_7357Help
Entry
SHJGH_7357        CDS       T02531                                 

Definition
(GenBank) non-hemolytic phospholipase C
  KO
K01114  phospholipase C [EC:3.1.4.3]
Organism
sho  Streptomyces hygroscopicus subsp. jinggangensis TL01
Pathway
sho00562  Inositol phosphate metabolism
sho00564  Glycerophospholipid metabolism
sho00565  Ether lipid metabolism
sho01100  Metabolic pathways
sho01110  Biosynthesis of secondary metabolites
sho02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:sho00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    SHJGH_7357
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    SHJGH_7357
   00565 Ether lipid metabolism
    SHJGH_7357
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    SHJGH_7357
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:sho02042]
    SHJGH_7357
Enzymes [BR:sho01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.3  phospholipase C
     SHJGH_7357
Bacterial toxins [BR:sho02042]
 Type II toxins: Membrane damaging toxins
  Toxins that enzymatically damage the membrane
   SHJGH_7357
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphoesterase DUF756 TAT_signal
Motif
Other DBs
NCBI-ProteinID: AGF67019
Position
8339870..8341918
Genome map
AA seq 682 aa AA seqDB search
MSEVNRRRFLQIAGATTAFTALSSSIQRAAALPAHHRTGSVDDVEHIVVLMQENRSFDHY
FGSLRGVRGFGDPRPVTQNGRSVWKQSDGTKDILPFHPDADDLGLAFIQDLPHGWNDGHT
AFNGGKYDKWVPAKSATTMAYLTRDDIPFHYALADAFTICDAYHCSFIGSTDPNRYYMWT
GYTGNDGKGGGPVLGNDEAGYGWTTYPERLERAGVSWKIYQDVGDGLDATGGWGWINDAY
RGNYGDNSLLYFNQYRDAKPGDPLYDKARTGTDARKGEGFFDQLKADVRAGKLPQVSWIV
APEAFTEHPNWPANYGAWYVSQVLDALTSDPEVWGKTALFITYDENDGFFDHVIPPYPPA
SAAQGKSTVDPAPDLFKGDAGHAAGPYGLGQRVPMLVVSPWSKGGYVCSETLDHTSIIRF
IERRFGVQEPNISPWRRAVCGDLTSAFDFSRKDTARVVLPSTAGYQPKDHDRHLDYVPKP
PAGGTLPRQEPGSRPTRPLKYAPVVDGSADTAAGKFTLTFASGAHAGAVFLVTSDNRADG
PWTYTTEAGKTLSDTWNSAYSGGDYDLAVHGPNGFLRVFKGRNKAAGPEVTARHKGDDVE
LTFTNKGSGTAKLKLVNGYGGKPVTVTVRPGATVRHTVALGSSKRWYDLTVTCDADPAFL
RGFSGHVENGRPGVSDPAIVTG
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaagtcaaccggcggcgcttcctccagatcgcgggcgccaccacggcgttcacg
gcgctgtccagcagcatccagcgcgcggcggccctgcccgcccaccaccgcacaggatcg
gtggacgatgtggagcacatcgtcgtcctcatgcaggagaaccgttccttcgaccactac
ttcggttcgctgcgaggagtccgcggcttcggcgacccccgtccggtcacccagaacggc
aggtccgtctggaagcagtccgacggcacgaaggacatcctgcccttccacccggacgcc
gacgacctgggcctggccttcatccaggacctcccgcacggctggaacgacggacacacc
gccttcaacggcggcaagtacgacaagtgggtacccgccaagtccgccacgacgatggcg
tacctcacccgcgacgacattcccttccactacgcgctcgcggacgccttcaccatctgc
gacgcctaccactgctcgttcatcggctccacggacccgaaccgctactacatgtggacc
gggtacaccggcaacgacggcaagggcggcggcccggtcctcggcaacgacgaggcgggc
tacggctggaccacgtaccccgagcgcctggagcgggccggggtctcctggaagatctac
caggacgtcggcgacggcctcgacgcgaccggcggctggggctggatcaacgacgcctac
cgcggcaactacggcgacaactcgctgctgtacttcaaccagtaccgcgacgccaagccc
ggcgacccgctgtacgacaaggcccgcaccggcaccgacgcccgcaagggcgagggcttc
ttcgaccagctgaaggcggacgtccgggccggcaagctgccccaggtctcctggatcgtc
gcccccgaggccttcaccgagcacccgaactggcccgccaactacggtgcctggtacgtc
tcccaggtcctggacgcgctcacctccgaccccgaggtgtgggggaagaccgcgctgttc
atcacctacgacgagaacgacggcttcttcgaccacgtcatcccgccctacccgccggcc
tcggccgcccagggcaagtcgacggtcgaccccgcgccggacctcttcaagggcgacgcc
ggccatgccgccggcccctacgggctcggccagcgggtgccgatgctggtggtctccccc
tggagcaagggcgggtacgtctgctcggagaccctcgaccacacctcgatcatccggttc
atcgagcgacgtttcggtgtccaggagccgaacatctcgccctggcggcgggccgtgtgc
ggcgacctgacgagcgccttcgacttctcccgcaaggacaccgcgcgggtcgtgctgccc
tccacggccggctaccagcccaaggaccacgaccgccacctcgactacgtgcccaagcct
cccgccggcggcacccttccccggcaggagccgggcagccggcccacccgcccgctgaag
tacgcccccgtggtcgacggctcggcggacaccgcggccggcaagttcacgctcacgttc
gcctcgggggcgcacgcgggggcggtcttcctcgtcacgtccgacaaccgtgccgacggc
ccctggacgtacaccacggaggccggcaagaccctctcggacacctggaactcggcgtac
tccggcggcgactacgacctcgccgtgcacggccccaacggcttcctgcgcgtcttcaag
ggccgcaacaaggccgccggccccgaggtcaccgcccggcacaagggcgacgacgtcgag
ctcaccttcaccaacaagggctccggcacggcgaagctgaagctggtcaacggctacggc
ggcaagccggtgacggtgacggtccggcccggcgcgaccgtgcggcacaccgtcgcgctg
ggatccagcaagcgctggtacgacctgaccgtgacctgcgacgccgacccggccttcctg
cgcggcttctccgggcacgtggagaacgggcgccccggcgtcagcgacccggcgatcgtc
acggggtga

DBGET integrated database retrieval system