KEGG   Streptomyces hygroscopicus subsp. jinggangensis TL01: SHJGH_8413Help
Entry
SHJGH_8413        CDS       T02531                                 

Definition
(GenBank) ketoacyl ACP/CoA reductase-like protein
  KO
K22322  A-factor type gamma-butyrolactone 1'-reductase (1S-forming) [EC:1.1.1.413]
Organism
sho  Streptomyces hygroscopicus subsp. jinggangensis TL01
Brite
KEGG Orthology (KO) [BR:sho00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SHJGH_8413
Enzymes [BR:sho01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.413  A-factor type gamma-butyrolactone 1'-reductase (1S-forming)
     SHJGH_8413
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase THF_DHG_CYH_C Shikimate_DH Eno-Rase_NADH_b 3HCDH_N Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: AGF68075
Position
9585188..9585955
Genome map
AA seq 255 aa AA seqDB search
MPSQGLLHGKTVLITGASSGIGAAAAELFAQEGARVVLAARRADRLRELVAAIGAAGGQA
TAVVADVTRAGDMHAAVETALRTYGRLDAAFNNAGWTSTGTPMHLMDDAEYDRIMDVNAR
GVWNAMRAQIAVMLEHGGGSIVNTSSVAGIRATGASAPYIAAKHAVIGLSRAAADEYAEQ
RIRVNALAVGSTRSELMDQVLSDTPALFKPFTERAMQHRLAEPVEIAQTAAWLCSDRSSF
TTGAVIAADGGWTAR
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgccctcacagggcttgctgcacggcaagacggtcctcatcaccggagcgagcagcggc
atcggtgcggcggcggcggagctcttcgcccaggaaggggcccgcgtcgtcctggccgcc
cgccgcgcggaccggctgcgggaactggtggccgcgatcggcgcagcgggtgggcaggcc
acggccgtggtggcggacgtgacccgcgcgggtgacatgcacgcggccgtggagacggcg
ctgcggacctacggccggctcgacgccgccttcaacaacgccgggtggacctccaccggt
acgcccatgcacctgatggacgacgcggagtacgaccgcatcatggacgtcaacgcccga
ggcgtgtggaacgcgatgcgggcacagatagccgtgatgctcgaacacggcggcggctcc
atcgtgaacacttccagtgtcgccgggatccgagcgaccggcgcctccgccccctacatc
gcggccaagcacgccgtcatcggcttgagcagggccgcggccgacgagtacgcggaacag
cgcatccgcgtcaacgcactcgccgtcggcagcacccggagcgagctgatggaccaggtg
ctctccgacacgcccgcgctgttcaagccgttcaccgagcgcgccatgcagcaccgcctg
gccgaacccgtggaaatcgcccagacggccgcatggttgtgctcggaccgctcgtcgttc
accacgggcgccgtcatcgcagccgacgggggatggacggcccgttag

DBGET integrated database retrieval system