KEGG   Staphylococcus hominis: EGX58_05230Help
Entry
EGX58_05230       CDS       T06045                                 

Gene name
nagA
Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
shom  Staphylococcus hominis
Pathway
shom00520  Amino sugar and nucleotide sugar metabolism
shom01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:shom00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    EGX58_05230 (nagA)
Enzymes [BR:shom01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     EGX58_05230 (nagA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: AYY66336
Position
1014026..1015180
Genome map
AA seq 384 aa AA seqDB search
MSQYVITNGRIYTEAQVIEKGYLVVENGKISDIQKGDYKGHLNQIDVAGKHVLPGFIDIH
IHGGYGEDAMDASYDGLNHLAKQLLSEGTTTFLATTMTQSDENIEKALKNIVACYENQTL
GEAAEISGVHLEGPFISEHKVGAQNPKYVQRPTVDKIRHFQEVAKGLIKIITFAPEVEGA
HDTLNELRDEIIFSMGHTVATFEEANEAVERGAKHVTHLYNAATPFEHRNPGVFGAAWTN
QSLNTEIIGDGIHSHPAAVDIAYKQKGYTHMYLITDAMRAKGMKDGEYDLGGQNVIVKGK
EARLENGALAGSILKMNEGLHNLIQFTHDSLDHLWRVASLNQAIALNIDKQKGSLSIGKD
ADIVIVDDHIQVDTTIKSGTIHHF
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaatatgtcattacaaatggaagaatttatacggaagcacaagttattgaaaaa
gggtatcttgtcgtagaaaatggcaaaattagtgatattcaaaaaggtgattataaaggt
catttaaatcaaatagatgtagcaggaaagcatgtgttaccaggttttatcgatattcat
attcatggtggctatggagaagatgcgatggatgcatcgtatgacggcttaaatcattta
gctaaacaattattgtctgaagggacaacaacatttttagcaacaacgatgacgcaatct
gatgagaatattgaaaaagcattaaaaaatattgtcgcatgttatgaaaatcaaacgtta
ggtgaagcagctgaaatcagtggtgtacatttagaaggaccatttatttctgaacataaa
gtgggtgctcaaaatcctaaatatgtacaacgtcccactgttgataaaattcgacatttt
caagaggtagcgaaaggattaattaaaatcattacttttgcgccagaagtcgaaggcgct
catgacacgttaaatgaattgcgtgatgagattattttttcaatgggacatactgtcgcc
acatttgaagaagcaaatgaagcggtagaacgaggtgcgaaacatgtaacgcatctttac
aacgctgcaacaccttttgagcatcgtaatccaggtgtatttggtgccgcttggaccaat
caaagtttaaacactgaaattattggtgatggtattcattcacatcctgctgctgtagat
attgcatataagcaaaaaggatatactcacatgtatttaattacagatgccatgcgtgcc
aaaggtatgaaagatggtgagtatgatttaggtggacaaaatgtgattgttaaagggaaa
gaagcacgtttagaaaatggcgcacttgcaggcagtattttaaaaatgaatgaaggactg
cataatttaattcaatttacgcatgatagtttagaccacttatggcgagtggcaagttta
aatcaagccattgcgcttaatatagataagcaaaaaggaagcttaagcataggaaaagat
gcagatatcgtaattgttgacgaccatatacaagtggatacaacaattaaatcaggtacc
attcatcatttttaa

DBGET integrated database retrieval system