KEGG   Staphylococcus hominis: EGX58_05915Help
Entry
EGX58_05915       CDS       T06045                                 

Gene name
mqo
Definition
(GenBank) malate dehydrogenase (quinone)
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
shom  Staphylococcus hominis
Pathway
shom00020  Citrate cycle (TCA cycle)
shom00620  Pyruvate metabolism
shom01100  Metabolic pathways
shom01110  Biosynthesis of secondary metabolites
shom01120  Microbial metabolism in diverse environments
shom01200  Carbon metabolism
Module
shom_M00009  Citrate cycle (TCA cycle, Krebs cycle)
shom_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:shom00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    EGX58_05915 (mqo)
   00620 Pyruvate metabolism
    EGX58_05915 (mqo)
Enzymes [BR:shom01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     EGX58_05915 (mqo)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO K_oxygenase NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AYY66464
UniProt: A0A4Q9WRC9
Position
1177819..1179321
Genome map
AA seq 500 aa AA seqDB search
MTESKDMIIVGAGVISTTVASMFNELVPNWNIDLYERLDRPGIESSNERNNAGTGHAALC
ELNYTVRQPDGTIDIEKAKEINEQFEISKQFWGHLVESGQIKDPRDFIHPLPHISFVRGK
NNVQFLKERYEKMKDFPMFDDIEYTEDIEVMRKWIPLMMQGRFDDGLMAASKIDEGTDVN
YGELTRKMAHNLQNDDSNVNVNYNHEVQDFKRLSNGKWQVKIKDLANNKVFTKEADHVFI
GAGGGSIPLLQKTGIEEGKHIGGFPIIGQFIACTNPEVIEQHDAKVYGKEPPGTPPMTVP
HLDTRYIDGERTLLFGPFANVGPKFLIHGSNLDLFKSVKPHNITTLLAAAVKNMSLLKYS
FDQIIMTKEGCMNHLRTFYPEARDEDWQVYTAGTRVQVIKDDEKEGKGFIQFGTEVVDSK
DHSIIALLGESPGASTSVSVALEVIERNFEQYLDEWKPKIKKMIPSYGESLIHDVDLMRK
TRRLTSKQLELGFYENTNAK
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgacagaatcaaaagatatgattattgtcggtgctggtgtaattagtacaacagttgca
tctatgttcaatgaacttgtacctaactggaacatcgatctttatgaacgtttagatcgt
ccaggtattgaaagttcaaatgaacgtaacaatgctggtactggtcacgctgcattatgt
gaattaaactatactgtaagacaaccagatggtacgattgacattgaaaaagcaaaagaa
attaatgaacaatttgaaatttctaaacaattttggggtcatttagtagaatcaggacaa
attaaagatcctagagatttcattcatcctttaccacatatcagtttcgtacgtggtaaa
aacaacgttcaattcctaaaagaacgttacgaaaaaatgaaagatttcccaatgttcgat
gatatcgaatatactgaagacatcgaagtaatgagaaaatggattccattaatgatgcaa
ggtcgtttcgatgatggcttaatggctgctagtaaaatcgacgaaggtactgacgttaac
tacggtgaattaactcgtaaaatggcacataacttacaaaacgacgattcaaacgtaaac
gtcaactataatcatgaagtacaagacttcaaacgtttatctaacggtaaatggcaagtt
aaaattaaagacttagctaacaataaagtctttactaaagaagctgaccatgtattcatc
ggtgctggtggtggatctattccattattacaaaaaactggtatcgaagaaggtaaacat
atcggtggtttcccaatcattggtcaatttatcgcttgtacaaatccagaagttatcgaa
caacatgatgcgaaagtttatggtaaagagccacctggcacaccaccaatgactgttcct
cacttagatactcgttatatcgatggtgaaagaacattattattcggaccattcgcaaat
gttggtcctaaattcttaattcacggttctaacttagatttattcaaatcagttaaacca
cacaatatcactacgttattagctgcagcagttaagaatatgtcattacttaaatattca
tttgaccaaatcatcatgactaaagaaggttgtatgaaccacttacgtacgttctaccct
gaagctcgtgatgaagattggcaagtatatactgctggtacacgtgtacaagttattaaa
gatgatgaaaaagaaggtaaaggattcatccaattcggtacagaagtggttgactctaaa
gaccactctatcattgctttacttggtgaatcaccaggggcttctacatcagtttcagta
gcgttagaagttatcgaaagaaacttcgaacaatatttagatgaatggaaaccaaaaatc
aaaaaaatgattccttcatatggtgaatcattaattcatgatgttgacttaatgagaaaa
actcgtcgtttaacatctaaacaattagaattaggtttctatgaaaatactaatgctaaa
taa

DBGET integrated database retrieval system