KEGG   Staphylococcus hominis: EGX58_07510Help
Entry
EGX58_07510       CDS       T06045                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
shom  Staphylococcus hominis
Pathway
shom03010  Ribosome
Brite
KEGG Orthology (KO) [BR:shom00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    EGX58_07510
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:shom03011]
    EGX58_07510
Ribosome [BR:shom03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    EGX58_07510
  Bacteria
    EGX58_07510
  Archaea
    EGX58_07510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 Peptidase_C92
Motif
Other DBs
NCBI-ProteinID: AYY66773
UniProt: A0A1L8Y7V3
Position
1509691..1510044
Genome map
AA seq 117 aa AA seqDB search
MEAKAVARTIRIAPRKVRLVLDLIRGKNAGEAIAILKLTNKASSPVIEKVLMSALANAEH
NYDMNTDELVVKEAYANEGPTLKRFRPRAQGRASAINKRTSHITIVVSDGKEEAKEA
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
atggaagcaaaagcggttgctagaacaatcagaatcgcacctcgtaaagtaagattagtt
cttgacttaattagaggtaaaaatgctggagaagctattgctattttaaaattaactaat
aaagcttcatcaccagtaattgaaaaagtattaatgtccgctttagcaaatgctgaacat
aactatgacatgaatacagatgaattagttgttaaagaagcatatgcaaatgaaggacca
actttaaaacgtttccgtccacgtgcacaaggtcgtgcaagtgcaatcaacaaacgtaca
agccacattacaatcgtcgtaagtgacggtaaagaagaagctaaagaagcttaa

DBGET integrated database retrieval system