KEGG   Shewanella putrefaciens 200: Sput200_0329Help
Entry
Sput200_0329      CDS       T02015                                 

Definition
(GenBank) phosphopantothenoylcysteine decarboxylase/phosphopantothenate/cysteine ligase
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
shp  Shewanella putrefaciens 200
Pathway
shp00770  Pantothenate and CoA biosynthesis
shp01100  Metabolic pathways
Module
shp_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:shp00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Sput200_0329
Enzymes [BR:shp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     Sput200_0329
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     Sput200_0329
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein DUF4573
Motif
Other DBs
NCBI-ProteinID: ADV52815
UniProt: E6XFK2
Position
complement(348443..349654)
Genome map
AA seq 403 aa AA seqDB search
MSLTNKNVLLGIGGGIAAYKSADLVRRLKERGFDVRVVMSQSAMEFITPLTLQALSGHPV
ASSLLDPAAEAAMGHIELARWADLVIIAPATANLLARINAGMADELITTTCLATEAPIAL
CPAMNQQMYRNLATQANLTSLQSRGYTLWGPASGSQACGEVGPGRMLEPLEIAELASDFF
ATKEVSAQPLAGQSVLITAGPTREAIDPVRYISNHSSGKMGFALAKAAADMGAAVTLISG
PVNLSTPEGVARIDVESAQNMLDAVMDNVDKKNIFIGCAAVADYRISDIATCKIKKSAEK
MQLALERNPDILATVASLPNRPFVVGFAAETHDVETYARDKLKRKNLDMIAANDVSVTGQ
GFNADTNALRVFWPLGSQDLPATDKLTLARQLLSLIVKEKINT
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
gtgagtctcacaaataaaaacgtcctgctgggcattggcggcggcattgccgcctataaa
agtgccgatttagtgcgacgcttaaaagagcgtggttttgatgtgcgcgtcgtaatgagc
caaagtgcgatggaatttatcacgcctctcacgctgcaagcgttatctggacatcctgtg
gcatctagcctactggatcctgcggcagaagctgctatgggccatatagagcttgctcgt
tgggccgatttagtgattatcgcccccgctacggccaacttactcgcccgtatcaatgca
ggcatggcagatgagttaattaccacaacctgcctagctaccgaagcccccatcgctctg
tgtccagcgatgaatcaacagatgtatcgtaatctcgccactcaagcgaatttaacaagc
ctgcaaagccgtggttataccctttggggtccagccagcggtagtcaagcatgcggcgaa
gtcggccctggacgcatgctcgaaccgctagaaattgccgagctagccagtgattttttt
gcaacaaaagaagtctctgcacagcctcttgcaggccagtcggtgctgatcaccgccggg
ccaacccgtgaagcgatagatcccgtcagatatatttccaatcacagttctgggaaaatg
ggctttgcgctcgccaaagccgcagcggatatgggcgcagccgtcaccttaatctcaggt
ccagtgaacctaagtacccctgaaggcgtagcacgcatcgatgttgaatctgcgcaaaat
atgctcgacgctgttatggataatgttgataagaaaaatatttttattggctgcgccgcc
gttgcagactaccgcattagcgatattgctacttgtaagatcaaaaaatcggcagaaaaa
atgcaacttgcgctagaaaggaatcctgatatcttagccacggttgcgagcttgcccaac
cgtccttttgtggtgggatttgccgccgaaacccatgatgttgaaacctacgcccgcgat
aaactcaaacgtaaaaacttggatatgatcgccgctaatgacgtttcagttactggccaa
ggcttcaatgccgataccaatgccctgcgtgtattctggccgctcggcagtcaagatttg
cctgcgaccgacaaactcacgctagcacggcaattactttcgttgatagtgaaagaaaaa
ataaatacatga

DBGET integrated database retrieval system