KEGG   Shewanella putrefaciens 200: Sput200_1246Help
Entry
Sput200_1246      CDS       T02015                                 

Definition
(GenBank) malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
shp  Shewanella putrefaciens 200
Pathway
shp00620  Pyruvate metabolism
shp00630  Glyoxylate and dicarboxylate metabolism
shp01100  Metabolic pathways
shp01110  Biosynthesis of secondary metabolites
shp01120  Microbial metabolism in diverse environments
shp01200  Carbon metabolism
Module
shp_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:shp00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Sput200_1246
   00630 Glyoxylate and dicarboxylate metabolism
    Sput200_1246
Enzymes [BR:shp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Sput200_1246
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: ADV53717
UniProt: E6XQ93
Position
1387068..1388795
Genome map
AA seq 575 aa AA seqDB search
MVIGDATALEVSVKPVNSGASWEGIKMTEHTLSEQQLNSTLGKAAPNATLDIVGPDIPGQ
EVIFTDGAVALLESLCREFAGEVPVLLAKRKEKQARIDKGGLPDFLPETRAIRDGAWQIR
GIPTDLLDRRVEITGPVERKMVINALNANAKVFMADFEDSLAPSWQKVVEGQINLRDAVR
GDIEYTAPETGKHYKLGPHPAVLICRVRGLHLKEKHVQFNGESIPGSLFDFALYFYHNYR
QLLAKGSGPYFYIPKLESHIEARWWAKVFAFVEERFCLQAGTIKCTCLIETLPAVFEMDE
ILYELRSNIVALNCGRWDYIFSYIKTLKRHSDRVLPDRQAVTMDTPFLSAYSRLLIKTCH
KRGALAMGGMAAFIPAKDPAQNEAVLQRVRRDKELEARNGHDGTWVAHPGLADTAMGIFN
EYIGQDHCNQLHITRDVDAPILAAELLKTCDGERTEQGMRLNIRIALQYLEAWISGNGCV
PIYGLMEDAATAEISRASIWQWIQHGKSLSNGKLVTKQLFKDMLVEELANVKEEVGSDRF
TSGKFTQAAVLLEDITTSDELVDFLTLPGYEMLTA
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
gtggtgattggggatgctactgctttagaagtcagcgttaagcctgtgaatagtggagcc
tcttgggagggcatcaagatgacggaacacactttgagtgagcagcaattgaattcgaca
ctgggtaaagccgcaccaaacgcgacacttgatattgtggggcctgatattcctggacaa
gaggtgatttttaccgacggggctgtagccttactcgaatctctttgccgcgagtttgct
ggcgaggttcctgtgctacttgctaaacgtaaagaaaagcaagctcgcatcgataaaggg
ggattaccagacttcttacctgaaacccgtgctattcgggatggtgcgtggcaaatccgc
gggatcccaacagatcttctcgaccgtagagtcgaaattactggccccgttgaacgtaaa
atggtgatcaatgcgcttaatgctaacgcaaaagtatttatggccgatttcgaggactct
ttagcgccaagttggcaaaaagtggtagaaggccagattaacctgcgtgatgctgttcgt
ggtgatatcgaatataccgcgccagaaacaggtaaacattacaaacttggccctcatccg
gcagtacttatttgccgtgttcgcggcttacatttgaaagaaaagcatgtgcaatttaac
ggtgagtctattcctggttcactgttcgatttcgcactgtatttctatcacaactatcgc
caactcttagcaaagggcagtggtccatacttctatattcctaagttagaaagccatatt
gaagctcgctggtgggcaaaggtgtttgcttttgttgaggaaagattttgtcttcaagca
ggcacaatcaaatgtacttgcctaattgagactttgcctgccgtgttcgagatggacgaa
attctctatgaattgcggtctaatattgtggcgcttaattgtggccgttgggattacatt
ttcagctatatcaaaacattaaaacgccatagcgaccgagtgttacccgatcgtcaagct
gtcactatggatacacccttcttaagtgcttattcaagactcctgattaagacctgccac
aaacgcggtgctttagcgatgggcggtatggcagcctttattccagcaaaagatcccgct
cagaacgaagcagtattgcagcgggttcgtcgggacaaagagcttgaggcgcgtaatggc
cacgatggtacttgggtcgcccatcccggtcttgccgataccgcgatggggatttttaac
gaatatataggtcaagatcattgtaatcaattacatattacccgtgatgtagatgctccc
attctagcggctgagttacttaaaacctgcgatggtgagcgtactgagcaaggtatgcgt
cttaatattcgtattgcgttgcagtatttagaggcgtggattagtggcaatggctgtgta
cctatttatggtttgatggaggacgcggctaccgccgaaatttctagagcctcaatttgg
caatggatccaacatggtaagtcactctctaatggcaagcttgtgactaagcaactcttc
aaggacatgttggtggaagaactcgcgaatgtgaaggaagaagtgggaagtgacagattt
accagtggcaaattcacccaagcggcggtgttactggaagatattactacctctgatgag
ttggtcgatttcttaactttacccggttacgagatgctaacggcttaa

DBGET integrated database retrieval system