KEGG   Shewanella putrefaciens 200: Sput200_1401Help
Entry
Sput200_1401      CDS       T02015                                 

Definition
(GenBank) phenylalanine-4-hydroxylase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
shp  Shewanella putrefaciens 200
Pathway
shp00360  Phenylalanine metabolism
shp00400  Phenylalanine, tyrosine and tryptophan biosynthesis
shp00790  Folate biosynthesis
shp01100  Metabolic pathways
shp01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:shp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    Sput200_1401
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Sput200_1401
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Sput200_1401
Enzymes [BR:shp01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     Sput200_1401
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-ProteinID: ADV53866
UniProt: E6XRW1
Position
1580681..1581481
Genome map
AA seq 266 aa AA seqDB search
MTKGTTYIARKADDTGYIDYSQEEHDIWSQLYARQAVNLPGRACLEYLNGLDALAMPKDR
IPQLAEVDLVLQATTGWKTAAVPALISFGHFFELLANKAFPVATFIRRKEEFDYLQEPDI
FHEIFGHCPLLTNPSFANFSHMYGQLGLNASKEERIFLARLYWFTVEFGLLQPKGGPLCI
YGGGILSSPGETLYAMESEVPERKPFDLLDVLRTPYRIDIMQPIYYVIEHIEMLDDIAKM
DIMSYVTKARQLGLFPPKYPPKAKAS
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaggaaccacctacatcgcccgcaaggctgatgacactgggtatatagattac
tcgcaagaagagcatgatatttggagccaactttacgcccgccaagcggttaatctccct
ggccgagcttgtctggaataccttaatggactcgatgcgttagcgatgccaaaggatcgt
attccacaactcgctgaagttgatcttgtattacaggcaacaacaggctggaaaacggca
gcagtacccgcactaatatcattcggccacttttttgaactcttagcgaataaagcgttt
ccagtggcgacattcattcgccgtaaggaagagtttgattacctgcaagaaccagatatt
tttcacgaaatttttggtcattgccctttgcttaccaatccttcatttgccaatttttcg
catatgtatggccaattgggtttaaatgctagcaaagaagaacggatatttttagcgcgt
ttatactggtttaccgttgagtttggcttacttcaaccaaaagggggccccttatgtatc
tatggcggtggcattttaagttcacccggtgaaaccctatatgcaatggagagcgaagta
cccgaacgtaagccctttgatttactggatgtgctgcgcacaccttaccgaatcgatatt
atgcaaccgatttactatgtgattgagcatattgagatgttggatgacattgccaaaatg
gacattatgagttatgtgactaaggctcgtcagttaggtttatttccccctaaatatcct
ccgaaagcgaaggcgagttaa

DBGET integrated database retrieval system