KEGG   Shewanella putrefaciens 200: Sput200_1412Help
Entry
Sput200_1412      CDS       T02015                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
shp  Shewanella putrefaciens 200
Pathway
shp00071  Fatty acid degradation
shp00072  Synthesis and degradation of ketone bodies
shp00280  Valine, leucine and isoleucine degradation
shp00310  Lysine degradation
shp00362  Benzoate degradation
shp00380  Tryptophan metabolism
shp00620  Pyruvate metabolism
shp00630  Glyoxylate and dicarboxylate metabolism
shp00640  Propanoate metabolism
shp00650  Butanoate metabolism
shp00900  Terpenoid backbone biosynthesis
shp01100  Metabolic pathways
shp01110  Biosynthesis of secondary metabolites
shp01120  Microbial metabolism in diverse environments
shp01130  Biosynthesis of antibiotics
shp01200  Carbon metabolism
shp01212  Fatty acid metabolism
shp02020  Two-component system
Brite
KEGG Orthology (KO) [BR:shp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Sput200_1412
   00630 Glyoxylate and dicarboxylate metabolism
    Sput200_1412
   00640 Propanoate metabolism
    Sput200_1412
   00650 Butanoate metabolism
    Sput200_1412
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Sput200_1412
   00072 Synthesis and degradation of ketone bodies
    Sput200_1412
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Sput200_1412
   00310 Lysine degradation
    Sput200_1412
   00380 Tryptophan metabolism
    Sput200_1412
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Sput200_1412
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Sput200_1412
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Sput200_1412
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:shp04147]
    Sput200_1412
Enzymes [BR:shp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Sput200_1412
Exosome [BR:shp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Sput200_1412
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ADV53877
UniProt: E6XRX2
Position
1592062..1593252
Genome map
AA seq 396 aa AA seqDB search
MSTEQLNQEIVIVAAKRTPMGGFQGSLSSVASPTLAATAIKGLLAETQLAGEHVDEVLMG
CVLPAGLGQAPARQATLGAGLPLSVGATTVNKVCGSGMKTVMLAHDLIKAGSAKVVIAGG
MESMSQAPYLLDKARSGMRMGHGKVLDHMFLDGLEDAYTGGAMGTFAQKTADEFGITREQ
MDAFALSSLEKANAAINSGAFKAEITPVTVSDRRGDVTVDTDEQPGNARPEKIPTLRPAF
TKDGTITAANSSSISDGAAALMLTSRGEAERLGLTVLATIKGHTTHAQEPSLFTTAPVGA
MAKLLANVGWSTDEVDLFEINEAFAMVTMLAVSELGLDVAKVNVNGGACALGHPIGCSGS
RLLVTLIHALKARGLKRGVASLCIGGGEATAMAIEV
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgagtactgaacagttaaatcaagagatcgttattgttgccgctaaacgcacccctatg
ggtggttttcaaggcagtttgtcatctgtagcatcaccgactttagctgcgacagccatt
aagggcttgttggcggagactcaattagcgggtgagcatgttgatgaagtcttgatgggc
tgcgtattacccgcaggtttaggtcaagcgcctgcgcgtcaggcaactttaggtgcgggg
ctacccttatccgttggtgcgaccacagtgaacaaagtctgtggctcaggcatgaagacg
gtaatgttagcccacgatttgattaaagcgggcagtgcaaaagtggtgatcgcaggtggc
atggaaagcatgagccaagcgccgtatctattagataaagcccgaagcggcatgcgtatg
ggccacggcaaagtgttagatcacatgtttttagatggtcttgaggatgcttatactggc
ggcgccatgggaacatttgcccagaaaaccgccgatgaatttgggatcacccgcgagcag
atggacgcttttgctctaagctcgctcgaaaaagccaatgctgcgattaactcgggcgcc
tttaaggccgaaattaccccagtcacagttagtgatcgtcgcggtgatgtgactgtcgac
accgacgagcaacccggtaatgcccgccctgaaaaaattcctacgctgcgcccagctttt
accaaagatggcactatcacagcggctaactctagctctatttccgatggcgcagcggca
ttgatgctgacctctcgaggcgaagctgagcgtttaggcttaactgtattagccaccatc
aaaggccacacgacccacgcccaagagccttcactctttaccactgcacctgtcggcgct
atggctaaattgctggccaatgtgggttggtcaacggatgaagtcgatttattcgaaatc
aacgaagccttcgccatggtgactatgcttgccgtgtctgaactgggtttagatgtggct
aaggttaacgtcaatggcggcgcttgcgctttaggtcatcctattggctgttctggttca
cgtttactagtgaccttaatccatgctttaaaagcccgaggccttaaacgcggtgttgcc
tcgctgtgtatcggcggtggtgaagcgacggcgatggcgattgaggtttaa

DBGET integrated database retrieval system