KEGG   Shewanella putrefaciens 200: Sput200_2243Help
Entry
Sput200_2243      CDS       T02015                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
shp  Shewanella putrefaciens 200
Pathway
shp00450  Selenocompound metabolism
shp00970  Aminoacyl-tRNA biosynthesis
shp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:shp00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Sput200_2243
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Sput200_2243
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:shp01007]
    Sput200_2243
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:shp03016]
    Sput200_2243
Enzymes [BR:shp01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     Sput200_2243
Amino acid related enzymes [BR:shp01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   Sput200_2243
Transfer RNA biogenesis [BR:shp03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Sput200_2243
 Prokaryotic type
   Other AARSs
    Sput200_2243
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Adenyl_transf Anticodon_1
Motif
Other DBs
NCBI-ProteinID: ADV54690
UniProt: E6XNA0
Position
2558259..2560328
Genome map
AA seq 689 aa AA seqDB search
MATSQRKILVTSALPYANGPIHLGHMLEYIQTDIWSRYQKLRGHECHYICADDAHGTPIM
LKAQQLGLAPEEMIAQVNKEHQQDFADFNIAFDNYHSTHSDENRVLASDIYLKLRANGYI
KSKSISQLFDPEKSMFLPDRFVKGTCPKCKSPDQYGDNCDACGATYSPTELINPKSAVSG
ATPVMKDTEHFFFDLPAFEGMLKEWTRSGALQTEMANKLDEWFEQGLQQWDITRDAPYFG
FEIPDAPGKYFYVWLDAPIGYMGSFKNLCDKRPELSFDEFWAKDSKAEVYHFIGKDIVYF
HSLFWPAMLHGSGYRQPNSVYAHGYVTVNGAKMSKSKGTFIKARTYLDHLDPEYLRYYYA
AKLSSRIDDLDLNLEDFAQRVNSDLVGKLVNLASRTAGFITKRFDGKLAKIADTTLTEAF
LAKQEQIAEFYETREYGKAMREIMALADIANGFVADAAPWQMVKQDDQQEAAHQVCSNAL
NLFRILVTYLKPVLPRLAQDVEAFFQQTLTWDGLAQDMAGHEISPFKAMMQRVELDKVNA
MVADSKENLQVTADVPKTAKPEKTVESSNVSSEPLVDDPISETINFDDFAKIDLRIARIV
KAEHVAEADKLLKLQLDIGGETRQVFAGIKSAYSPEDLEGKLTVMVANLAPRKMRFGMSE
GMVLAAGPGGSDLWILEPHEGAQPGMRVK
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atggcaacttcacaacgtaaaattctcgtgaccagcgcacttccctacgcgaacggaccg
attcatttaggtcatatgctggaatacatccagacggatatctggtcgcgttaccaaaag
cttcgtggacatgagtgccactatatttgcgccgatgacgcccacggcacgccaattatg
ctcaaagcgcaacaattaggcctagcgcctgaagagatgattgctcaagtgaacaaagag
catcagcaggatttcgccgattttaatatcgccttcgataattatcacagcacccacagt
gacgaaaaccgcgtactggcgagtgatatttacttaaaactgcgtgctaatggctatatc
aagagcaagagcatttctcagttgttcgatcctgaaaaatcgatgttcctgccagaccgc
ttcgttaaaggcacctgccctaagtgtaaatcacccgatcaatacggcgataactgtgat
gcctgcggtgcaacatatagcccaactgagctgattaacccgaaatcggccgtctctggc
gctacgcctgtgatgaaagacactgagcacttcttcttcgacttacccgcctttgaaggc
atgctaaaagagtggactcgctctggcgctctgcaaacagaaatggccaacaaactcgac
gaatggttcgagcaaggcttacaacaatgggatatcacccgtgatgccccctattttggt
tttgaaattcccgatgcacctggcaaatatttctacgtttggctagatgcacctatcggt
tacatgggctcattcaaaaacctctgtgacaaacgtcctgaactcagcttcgatgaattt
tgggcgaaggattctaaggccgaggtttaccactttatcggtaaagacatcgtttacttc
cacagtctgttttggcctgccatgttacacggctcaggttaccgccagccaaacagcgtc
tatgcccacggctatgtgaccgtcaatggcgcaaaaatgtcgaaatccaaaggcactttc
atcaaggcgcgtacttatttagatcatttagatcctgaatatctacgttactactacgcc
gcaaaactcagcagccgtatcgacgatttagacctcaatctagaagacttcgcccagcgc
gtaaactcagatctggttggtaagttagtcaacctcgcatctcgcactgcgggttttatc
actaagcgtttcgatggcaagctcgcgaaaattgctgatactacactgaccgaggcgttt
ttagccaagcaagaacaaatcgccgagttttatgagacccgtgaatacggtaaagcgatg
cgtgaaatcatggcattagcggacatcgccaacggttttgtggccgatgcggcgccttgg
caaatggtgaaacaggacgatcaacaggaagcggcgcaccaagtgtgttcaaacgccttg
aatctgttccgtattctcgtgacgtatctaaaacctgtattgccacgtttagcccaagat
gttgaagccttcttccaacagaccttaacatgggatggcttagcccaagatatggcgggc
catgaaatctcgccattcaaagccatgatgcaacgtgttgagttagacaaagtcaacgct
atggtggccgactctaaggaaaacctgcaagtcacggccgatgtaccaaagacggcaaaa
cctgaaaaaaccgttgaatcatctaatgtcagcagtgagccgctggttgacgatcctatc
agtgaaaccatcaactttgatgattttgctaaaatcgacctacgtatcgctcgcatcgtc
aaagccgagcatgtggccgaagccgacaaactgctaaagttacagctcgatatcggcggc
gaaacgcgccaagtgtttgcagggatcaaatcggcctattcaccagaagatcttgaaggc
aagctgacggtgatggttgcaaaccttgcaccgcgtaagatgcgttttggcatgtcagaa
ggtatggttttggccgcaggcccaggtggtagtgacctgtggattttagagccccatgaa
ggcgcacagccgggtatgcgagttaaataa

DBGET integrated database retrieval system