KEGG   Shewanella putrefaciens 200: Sput200_2293Help
Entry
Sput200_2293      CDS       T02015                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
shp  Shewanella putrefaciens 200
Pathway
shp00020  Citrate cycle (TCA cycle)
shp00310  Lysine degradation
shp01100  Metabolic pathways
shp01110  Biosynthesis of secondary metabolites
shp01120  Microbial metabolism in diverse environments
shp01130  Biosynthesis of antibiotics
shp01200  Carbon metabolism
Module
shp_M00009  Citrate cycle (TCA cycle, Krebs cycle)
shp_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:shp00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Sput200_2293
  Amino acid metabolism
   00310 Lysine degradation
    Sput200_2293
Enzymes [BR:shp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Sput200_2293
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-ProteinID: ADV54740
UniProt: E6XNX0
Position
complement(2613542..2614744)
Genome map
AA seq 400 aa AA seqDB search
MSIEIKVPVLPESVADATIATWHVKVGEHVSRDQNLVDIETDKVVLEVVAPEDGHIGEFL
FQEGDTVLGEQVIAKFIAGAVAGQEVTKAQAEAAAPVAETSDESNDALSPSVRRLLAEHN
VDASKVKGTGVGGRITKEDVEAFVSSASKGAPKASAPAAPAVAPLAEGRSEKRVPMTRLR
KTIANRLLEAKNSTAMLTTFNEVNMKPIMDIRKQYQDIFEKRHGIRLGFMSFYVKAVTEA
LKRFPEVNASIDGDDIVYHNYFDISIAVSTPRGLVTPVLRDTDTMSLAEIEKAVRDLAIK
GRDGKLTVADMTGGNFTVTNGGVFGSLMSTPILNLPQSAILGMHAIKDRPMAVNGQVEIL
PMMYLALSYDHRIVDGRESVGFLVAIKDFLEDPTRLLLDL
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgagtatcgaaatcaaggtacccgtactaccagaatctgttgccgatgctacgattgcc
acttggcacgttaaagtgggtgagcatgtttctcgtgatcaaaatcttgttgatattgaa
acagataaagttgtactcgaagtggttgcacctgaagatggccacattggtgagtttctg
ttccaagaaggcgataccgtacttggtgaacaagtgattgctaagttcatcgcgggggct
gttgctggtcaagaagtcactaaagcccaagctgaagcggcagcaccggttgctgaaaca
agcgatgaaagtaatgatgcgttaagtccatctgtacgccgtttactggcagagcacaat
gttgatgctagcaaagtgaaaggtacaggtgtaggcggtcgtatcactaaagaagacgtt
gaagcttttgttagctctgcatcaaaaggggcgcccaaagcatcggctcctgcagcacct
gccgttgcgccattagcagaaggccgtagtgagaaacgtgtacctatgacacgtttacgc
aaaactatcgctaaccgtctattagaagcgaaaaactctaccgctatgctcacgacgttc
aacgaagtgaacatgaagcccatcatggatatccgtaagcagtaccaagatatctttgaa
aagcgccacggcatccgtttaggttttatgtctttctatgtgaaagcggtgacagaagcc
ctgaaacgcttcccagaagtgaacgcatcaatcgatggtgatgatattgtttatcacaat
tatttcgatattagcattgctgtatcaacaccacgtggtctggtaacacctgtcttacgt
gacacagatactatgagtcttgctgaaattgaaaaagcagtacgcgatctcgctatcaaa
ggccgtgatggcaaactgacggttgccgatatgactggtggtaacttcaccgtgactaac
ggcggcgttttcggttcactgatgtctacaccgatccttaacctgccacaaagtgcgatt
ttaggcatgcatgccattaaagatcgtccaatggcagtcaatggtcaggttgaaatcctg
cccatgatgtacctagcactctcatatgaccatcgtattgttgatggccgtgagtctgtt
ggtttcttggttgcgattaaagacttcctagaagacccaacacgtctgctgctcgatctt
taa

DBGET integrated database retrieval system