KEGG   Shewanella putrefaciens 200: Sput200_3351Help
Entry
Sput200_3351      CDS       T02015                                 

Definition
(GenBank) short-chain dehydrogenase/reductase SDR
  KO
K13938  dihydromonapterin reductase / dihydrofolate reductase [EC:1.5.1.50 1.5.1.3]
Organism
shp  Shewanella putrefaciens 200
Pathway
shp00670  One carbon pool by folate
shp00790  Folate biosynthesis
shp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:shp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Sput200_3351
   00670 One carbon pool by folate
    Sput200_3351
Enzymes [BR:shp01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Sput200_3351
    1.5.1.50  dihydromonapterin reductase
     Sput200_3351
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Epimerase KR GDP_Man_Dehyd NmrA RmlD_sub_bind
Motif
Other DBs
NCBI-ProteinID: ADV55740
UniProt: E6XMX2
Position
complement(3808325..3809044)
Genome map
AA seq 239 aa AA seqDB search
MTSPIIITGVGKRIGYALAKHLLAQGHSVIGTYRSHYPNIDKLRVLGATLIQCDFYDNVQ
VQGLIDQLSQYPKIRAIIHNASDWLADSSQTFTASEVIQRMMLVHVSVPYQLNLALASQL
QAGAEEEIGASDIIHITDYVAEKGSAKHIAYAASKAALHNLTLSFAAKFAPEVKVNSIAP
AMILFNQGDDEAYQQKTLAKALLPKEAGSEEIIDLVEYLLNSRYVTGRSHHVDGGRHLR
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgacatctcccatcatcatcacaggcgtgggtaaacgcataggttacgccttagccaaa
catcttcttgcccaaggtcatagtgtgattggcacctatcgtagccattatccgaatatt
gataagctgcgggttttgggcgcgactttaatccaatgtgacttttacgacaatgttcag
gtacaaggcttaattgatcaattgagccagtatccaaagatccgcgccattatccataac
gcctcggattggttggcggatagcagtcaaacctttactgccagtgaagtgatacagcgg
atgatgctggtgcacgtaagcgtaccttatcaattgaatttggcgttagcatcgcagttg
caagcgggagcagaagaggagattggtgccagcgatatcatccatatcaccgactatgtg
gccgaaaagggcagtgctaaacatatcgcttatgccgccagtaaagcggcgctacataat
ttaactttgtcctttgcggctaaattcgcccccgaagtgaaagtcaattcgattgcacca
gcgatgatcctatttaatcaaggcgatgatgaagcctatcagcaaaaaaccttagctaaa
gcactactgccaaaagaggcggggagtgaagagattatcgacttagtggaatatctgcta
aatagccgctatgtcacggggcgcagccatcatgtcgatggtggtcggcatttaaggtaa

DBGET integrated database retrieval system