KEGG   Shewanella putrefaciens 200: Sput200_3601Help
Entry
Sput200_3601      CDS       T02015                                 

Definition
(GenBank) Uroporphyrinogen III synthase HEM4
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
shp  Shewanella putrefaciens 200
Pathway
shp00860  Porphyrin and chlorophyll metabolism
shp01100  Metabolic pathways
shp01110  Biosynthesis of secondary metabolites
shp01120  Microbial metabolism in diverse environments
Module
shp_M00121  Heme biosynthesis, glutamate => heme
shp_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:shp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Sput200_3601
Enzymes [BR:shp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Sput200_3601
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 YdaS_antitoxin
Motif
Other DBs
NCBI-ProteinID: ADV55981
UniProt: E6XQR5
Position
4088514..4089254
Genome map
AA seq 246 aa AA seqDB search
MKVLLTRPEGRNQSMVDALNARGIAHYVTPLLGVEPTNDITTDASHPLAGTDIIICISAN
AVIFANKALNKINAQIATWPKVQYFAVGHATWEALDQLGICAVEAPDDCQQTEGLLTLAS
LQHIPAKKVTIIRGVGGREALAEQLTSRGANVRYWEVYQRVCPPLDGYAITQQWQHFGID
TIVVTSGEVLNNLIKLVPKELFAWLRSCHIIVPSNRVEAQAHAFGINHVTNACAANSKAV
LNALKL
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtgttactgacgcgcccagaagggcgcaatcagtctatggtcgatgccttgaat
gcacgaggcattgcccactatgtcacgccattattgggtgttgaaccaactaacgacatc
acaacggatgcttcgcatccattggcagggacagatattattatctgtatcagtgctaac
gctgttatttttgcgaataaagccttaaacaaaattaatgcacaaatagcaacatggcct
aaagttcaatattttgctgtgggccatgcaacatgggaggcattagatcagttaggcatt
tgcgcagttgaagcccccgatgattgccaacaaacggaaggcttacttacccttgcttct
ctacaacatattccagctaaaaaagtaacgattatacgtggtgttggtggccgcgaagct
ctcgctgagcaattaaccagccgtggcgcaaatgtacgctattgggaagtatatcagcga
gtgtgtccaccgttagacggatatgctattacacaacaatggcaacactttggtattgat
accattgtggtcaccagtggcgaagttctcaataacctgattaaactagtgccaaaagag
ttatttgcatggctgcgctcatgtcatatcatagtcccaagtaaccgagtagaagctcaa
gctcacgcctttggtataaaccacgtcaccaatgcctgtgccgccaacagcaaagccgtg
ctaaacgcccttaaactttaa

DBGET integrated database retrieval system