KEGG   Shigella sp. PAMC 28760: A0259_01655Help
Entry
A0259_01655       CDS       T04390                                 

Definition
(GenBank) homoserine O-succinyltransferase
  KO
K00651  homoserine O-succinyltransferase/O-acetyltransferase [EC:2.3.1.46 2.3.1.31]
Organism
shq  Shigella sp. PAMC 28760
Pathway
shq00270  Cysteine and methionine metabolism
shq00920  Sulfur metabolism
shq01100  Metabolic pathways
shq01110  Biosynthesis of secondary metabolites
shq01130  Biosynthesis of antibiotics
shq01230  Biosynthesis of amino acids
Module
shq_M00017  Methionine biosynthesis, apartate => homoserine => methionine
Brite
KEGG Orthology (KO) [BR:shq00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    A0259_01655
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    A0259_01655
Enzymes [BR:shq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     A0259_01655
    2.3.1.46  homoserine O-succinyltransferase
     A0259_01655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTS
Motif
Other DBs
NCBI-ProteinID: AMR21426
Position
342563..343492
Genome map
AA seq 309 aa AA seqDB search
MPIRVPDELPAVNFLREENVFVMTTSRASGQEIRPLKVLILNLMPKKIETENQFLRLLSN
SPLQVDIQLLRIDSRESRNTPAEHLNNFYCNFEDIQDQNFDGLIVTGAPLGLVEFNDVAY
WPQIKQVLEWSKDHVTSTLFVCWAVQAALNILYGIPKQTRTDKLSGVYEHHILHPHALLT
RGFDDSFLAPHSRYADFPAALIRDYTDLEILAETEEGDAYLFASKDKRIAFVTGHPEYDA
QTLAQEFFRDVEAGLDPDVPYNYFPHNDPQNTPRASWRSHGNLLFTNWLNYYVYQITPYD
LRHMNPTLD
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgccgattcgtgtgccggacgagctacccgccgtcaatttcttgcgtgaagaaaacgtc
tttgtgatgacaacttctcgtgcgtctggtcaggaaattcgtccacttaaggttctgatc
cttaacctgatgccgaagaagattgaaactgaaaatcagtttctgcgcctgctttcaaac
tcacctttgcaggtcgatattcagctgttgcgcatcgattcccgtgaatcgcgcaacacg
cccgcagagcatctgaacaacttctactgtaactttgaagatattcaggatcagaacttt
gacggtttgattgtaactggtgcgccgctgggcctggtggagtttaatgatgtcgcttac
tggccgcagatcaaacaggtgctggagtggtcgaaagatcacgtcacctcgacgctgttt
gtctgctgggcggtacaggccgcgctcaatatcctctacggcattcctaagcaaactcgc
accgacaaactctctggcgtttacgagcatcatattctccatcctcatgcgcttctgacg
cgtggctttgatgattcattcctggcaccgcattcgcgctatgctgactttccggcagcg
ttgattcgtgattacaccgatctggaaattctggcagagacggaagaaggggatgcatat
ctgtttgccagtaaagataagcgcattgcctttgtgacgggccatcccgaatatgatgcg
caaacgctggcgcaggaatttttccgcgatgtggaagccggactagacccggatgtaccg
tataactatttcccgcacaatgatccgcaaaatacaccgcgagcgagctggcgtagtcac
ggtaatttactgtttaccaactggctcaactattacgtctaccagatcacgccatacgat
ctacggcacatgaatccaacgctggattaa

DBGET integrated database retrieval system