KEGG   Shigella sp. PAMC 28760: A0259_02915Help
Entry
A0259_02915       CDS       T04390                                 

Definition
(GenBank) ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
shq  Shigella sp. PAMC 28760
Pathway
shq00220  Arginine biosynthesis
shq01100  Metabolic pathways
shq01110  Biosynthesis of secondary metabolites
shq01130  Biosynthesis of antibiotics
shq01230  Biosynthesis of amino acids
Module
shq_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:shq00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    A0259_02915
Enzymes [BR:shq01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     A0259_02915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace OTCace_N
Motif
Other DBs
NCBI-ProteinID: AMR21659
Position
complement(609202..610206)
Genome map
AA seq 334 aa AA seqDB search
MSGFYHKHFLKLLDFTPAELNSLLQLAAKLKADKKSGKEEAKLTGKNIALIFEKDSTRTR
CSFEVAAYDQGARVTYLGPSGSQIGHKESIKDTARVLGRMYDGIQYRGYGQEIVETLAEY
AGVPVWNGLTNEFHPTQLLADLLTMQEHLPGKAFNEMTLVYAGDARNNMGNSMLEAAALT
GLDLRLVAPQACWPEAALVTECRALAQQNGGNITLTEDVAKGVEGADFIYTDVWVSMGEA
KEKWAERIALLRDYQVNSKMMQLTGNPEVKFLHCLPAFHDDQTTLGKKMAEEFGLHGGME
VTDEVFESAASIVFDQAENRMHTIKAVMVATLSK
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgtccgggttttatcataagcatttcctgaaattactcgatttcacgccagctgaactc
aacagcctgctgcagttagccgcgaagctgaaagccgataagaaaagcggcaaagaagaa
gccaaactcactggtaaaaacatcgcgctcatcttcgaaaaagactcgacccgtacccga
tgctctttcgaagttgccgcatatgaccagggtgctcgcgttacttatctcggcccaagc
ggcagtcagattggtcataaagagtcgattaaagacactgcccgcgtgctgggtcgcatg
tatgacggtattcagtatcgcggctatggtcaggagattgtcgaaacactggcggaatac
gctggcgtgccggtatggaacggcctgaccaatgagtttcaccccacgcagttgctggcg
gatctcctcaccatgcaggagcatttacccggtaaagcattcaacgaaatgacgctggtc
tatgcaggtgacgcacgtaacaacatgggcaattcgatgctcgaagctgcggcgcttacc
ggtctggatttgcgtctggtcgcgccacaggcatgctggccggaagctgcgctggttacg
gaatgccgcgctctggcacagcaaaatggcgggaatattacgctgacggaagatgtagct
aaaggagttgaaggtgctgactttatctataccgatgtatgggtgtcgatgggtgaagca
aaagagaaatgggctgaacgcattgcattgctgcgtgattatcaagtgaacagcaagatg
atgcagttgaccggtaacccggaggtcaaattcctccactgcctgcccgcgtttcatgac
gaccaaacgacgcttggtaagaaaatggcggaagagtttggcctacatggcggaatggaa
gtgactgatgaggtcttcgaatctgccgccagcattgtttttgatcaggcggaaaaccgc
atgcataccatcaaagcggtgatggtagcgacgctcagtaaataa

DBGET integrated database retrieval system