KEGG   Shigella sp. PAMC 28760: A0259_07830Help
Entry
A0259_07830       CDS       T04390                                 

Definition
(GenBank) 8-amino-7-oxononanoate synthase
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
shq  Shigella sp. PAMC 28760
Pathway
shq00780  Biotin metabolism
shq01100  Metabolic pathways
Module
shq_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:shq00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    A0259_07830
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:shq01007]
    A0259_07830
Enzymes [BR:shq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     A0259_07830
Amino acid related enzymes [BR:shq01007]
 Aminotransferase (transaminase)
  Class II
   A0259_07830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Beta_elim_lyase Cys_Met_Meta_PP Aminotran_5 OKR_DC_1
Motif
Other DBs
NCBI-ProteinID: AMR22539
Position
1574501..1575655
Genome map
AA seq 384 aa AA seqDB search
MSWQDKINAALDARRAADALRRRYPVAQGAGRWLVADDRQYLNFSSNDYLGLSHHPQIIR
AWKQSAEQFGVGSGGSGHVSGYSVAHQALEEELAEWLGYSRALLFISGFAANQAVIAAMM
AKEDRIVADRLSHASLLEAASLSPSQLRRFVHNDVTHLARLLASPCPGQQMVVTEGVFSM
DGDSAPLAEIQQVTQQHNGWLMVDDAHGTGVIGEQGRGSCWLQKVKPELLVVTFGKGFGV
SGAAVLCSSTVADYLLQFARHLIYSTSMPPAQAQALRASLAVIRSDEGDARREKLAALIT
RFRAGVQDLPFTLADSCSAIQPLIVGDNSRALQLAEKLRQQGCWVTAIRPPTVPAGTARL
RLTLTAAHEMQDIDRLLEVLHGNG
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgagctggcaggataaaatcaacgcggccctcgatgcgcggcgtgctgccgatgccctg
cgtcgccgttatccagtggcgcaaggagcaggacgctggctggtggcggacgatcgccag
tatctgaacttttccagtaacgattatttaggtttaagccatcatccgcaaattatccgt
gcctggaagcagagtgcggagcaatttggcgtcggtagcggcggctccggtcacgtcagc
ggttatagcgtggcacatcaggcgctggaagaagaactggccgagtggctgggctattcg
cgggcactgctgtttatctctggttttgccgctaatcaggcggtcattgccgcgatgatg
gcgaaagaggaccgtattgttgccgaccggcttagccatgcctcattgctggaggctgcc
agtttaagcccgtcgcagcttcgccgttttgttcataacgatgtcactcatctggcgcga
ctgcttgcttccccctgtccggggcagcaaatggtggtgacagaaggcgtgttcagcatg
gacggcgatagtgcgccactggcggaaatccagcaggtaacgcaacagcacaatggctgg
ttgatggtcgatgatgcccacggcacgggcgttatcggggagcaggggcgcggcagctgc
tggctgcaaaaggtaaaaccagaattgctggtagtgacttttggcaaaggatttggcgtc
agcggggcagcggtgctttgctccagtacggtggcggattatctgctgcaattcgcccgc
caccttatctacagcaccagtatgccgcccgctcaggcgcaggcattacgtgcgtcgctg
gcggtcattcgcagtgatgagggtgatgcacggcgcgaaaaactggcggcactcattacg
cgttttcgtgccggagtacaggatttgccgtttacgcttgctgattcatgcagcgccatc
cagccattgattgtcggtgataacagccgtgcgttacaactggcagaaaaactgcgccag
caaggctgctgggtcacggcgattcgcccgccaaccgtacccgctggtactgcgcgactg
cgcttaacgctaaccgctgcgcatgaaatgcaggatatcgaccgtctgctggaggtgctg
catggcaacggttaa

DBGET integrated database retrieval system