KEGG   Shigella sp. PAMC 28760: A0259_13975Help
Entry
A0259_13975       CDS       T04390                                 

Definition
(GenBank) mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase
  KO
K00971  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
shq  Shigella sp. PAMC 28760
Pathway
shq00051  Fructose and mannose metabolism
shq00520  Amino sugar and nucleotide sugar metabolism
shq01100  Metabolic pathways
shq01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:shq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    A0259_13975
   00520 Amino sugar and nucleotide sugar metabolism
    A0259_13975
Enzymes [BR:shq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     A0259_13975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase MannoseP_isomer Cupin_2 NTP_transf_3
Motif
Other DBs
NCBI-ProteinID: AMR23656
Position
complement(2778759..2780183)
Genome map
AA seq 474 aa AA seqDB search
MSSPLIPVILSGGNGTRLWPLSREEYPKQFLKLTDSISMLQSTISRLDSLNTSSPVVICN
ELHRFIVAEQLRHLNKLDNNIILEPSGRNTAPAICIAALILKMKHPNENPLMLVLPADHS
VKKVKTFCNTIKSAIPFAEAGNLVSFGIKPTHPETGYGYIQKGKVLSDSDIYEVSEVRTF
VEKPNLKTAESFIEKDEYYWNSGMYLFSVERYLQELSLYRPDIVKVCQETVKNIHYDMDF
IRLDDKIFRNCPQESIDYAVMEKTKDAVVATMDIGWNDVGAWSSLWELGKKDSSGNVITG
DIVCHETENSYIYTESGLVATIGIQDLVIIHTKDSLLVSRRDSVQNVKNIVQHLDLSGRK
EHKEHREVFKSWGRCDSIDSSEKYHYQVKRITVNPSEKLSLQLHHHRAEHWVVVMGIAKV
TVAEEIKILKENESVYIPAGIKHSLENIGTIPLVLIEVWTGSYLADDDILRFED
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgagctcacctcttattccggttatattaagtggtggtaatggtactaggttatggcca
ctatctagagaggaatatcctaagcagtttttaaaactaaccgactcaatatcaatgctg
caatcaacaatatctcggttagactcattaaatacttcctctccagttgtaatatgcaat
gaattacacagatttattgttgcagaacaactcaggcacttaaataaattagataataat
attattttagaaccatctggtcgcaatactgcacctgctatttgtattgctgctttaatt
ttaaaaatgaagcatccaaatgaaaatccacttatgctcgttcttccagccgatcactcc
gtaaaaaaagtcaaaactttttgtaatacaataaaaagtgctattcccttcgctgaagct
ggtaatttggtttcttttggtattaaacctactcatcctgagacggggtatggatatata
caaaaaggcaaagtgttatctgattctgatatatatgaggtcagtgaagttagaactttt
gttgaaaagcctaatcttaaaacagcagaaagctttatagaaaaagatgagtattattgg
aatagtggtatgtatttgtttagtgttgaacgttacttacaagagttatcattataccga
ccagacatagttaaagtatgccaggaaactgttaaaaatattcattatgatatggatttt
attagattggacgataaaatatttcggaactgtccacaggagtctattgattatgctgta
atggagaaaacaaaggatgctgtagttgctacaatggatatcggttggaatgatgtagga
gcatggtcttcgctttgggaattagggaaaaaagactcctctggtaatgttatcacggga
gacatcgtttgccacgagacagaaaatagttatatttatactgagtctggattggtagca
actattggtattcaagatcttgttattattcatactaaagattcattactggtttccaga
cgcgattcagtacaaaatgtaaaaaatattgttcagcatcttgatttgtcaggacgtaaa
gaacataaagaacatagggaagtattcaagtcatggggacgatgtgactccatagatagt
agtgaaaagtaccactatcaggtcaaacgaataacagttaatccaagtgaaaaattatcg
ttgcaattacatcatcaccgtgcggaacattgggttgttgtaatggggattgctaaagtt
acagttgcagaagaaataaaaattttaaaagagaatgagtctgtatatattcctgcaggt
attaagcatagtttggaaaatattgggacaataccacttgtgttaatagaagtttggacc
ggttcttatcttgctgatgatgatatccttcgatttgaagattga

DBGET integrated database retrieval system